SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0039
         (826 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.        24   1.5  
AY588474-1|AAT94401.1|  104|Apis mellifera defensin 2 protein.         23   4.5  
AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein ...    22   7.9  

>AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.
          Length = 200

 Score = 24.2 bits (50), Expect = 1.5
 Identities = 18/64 (28%), Positives = 27/64 (42%)
 Frame = -2

Query: 570 QAFHH*NCYSGLNPTSLKV*TLSTLIHTATI*EHLITGYITAVKKLYKI*SRQKKKDPRP 391
           Q FHH   +S  NP +++  T S    TA++   L    + A    Y     Q+   P P
Sbjct: 11  QQFHHQQLFSSANPGTIQACTTSPA--TASLESSLSAAAVAAAAVNY----AQQHNSPSP 64

Query: 390 PNSA 379
             S+
Sbjct: 65  TGSS 68


>AY588474-1|AAT94401.1|  104|Apis mellifera defensin 2 protein.
          Length = 104

 Score = 22.6 bits (46), Expect = 4.5
 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 2/29 (6%)
 Frame = +1

Query: 217 LSMNGSW--IFCMCEVYPGGVCNPSFCVC 297
           LS+N S   I C+ +   GG C    C+C
Sbjct: 74  LSINHSACAIRCLAQRRKGGSCRNGVCIC 102


>AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein 1
           protein.
          Length = 500

 Score = 21.8 bits (44), Expect = 7.9
 Identities = 11/39 (28%), Positives = 17/39 (43%)
 Frame = -1

Query: 736 HIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDL 620
           H    PY  + CG        LK + R++  E  +T D+
Sbjct: 198 HTGEKPYVCKACGKGFTCSKQLKVHTRTHTGEKPYTCDI 236


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 203,980
Number of Sequences: 438
Number of extensions: 4420
Number of successful extensions: 9
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26338809
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).