SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0036
         (830 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    26   0.49 
AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    23   2.6  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    22   6.0  
EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          22   8.0  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      22   8.0  
AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precur...    22   8.0  
AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.          22   8.0  

>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 25.8 bits (54), Expect = 0.49
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = -2

Query: 511 RTPDTCLKYNLKGVVAS*PNGSLSASCVIRIY 416
           RTPD CL YN   ++ S    S    C+I ++
Sbjct: 331 RTPDQCLFYNTDFIIYS-SLSSFYIPCIIMVF 361


>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 23.4 bits (48), Expect = 2.6
 Identities = 15/65 (23%), Positives = 28/65 (43%)
 Frame = -1

Query: 383 HSNEIYLLSIYIKMNCCSLVSLKLENGWTDLANFGLELFVEVQRRFKSLKKYENARNYIK 204
           H N I+L  +  K N   +++  +ENG  D      +   +V +    L+   +   Y+ 
Sbjct: 693 HPNVIFLQGVVTKSNPVMIITEFMENGSLDTFLRANDGKFQVLQLVGMLRGIASGMQYLA 752

Query: 203 TNNFV 189
             N+V
Sbjct: 753 EMNYV 757


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
           protein.
          Length = 1770

 Score = 22.2 bits (45), Expect = 6.0
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = -1

Query: 107 FIDRGTTKSDGSASINILISKSLTKQASS 21
           +I+RGTTKS  +A+I   + K++     S
Sbjct: 516 WIERGTTKSMEAANIMSKLPKTVRTPTDS 544


>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 7/20 (35%), Positives = 12/20 (60%)
 Frame = +3

Query: 228 IFFQTFKPSLDFYE*FKTKI 287
           +FF  +K  LD+Y  +K  +
Sbjct: 416 VFFSIYKTILDYYHKYKENL 435


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 7/20 (35%), Positives = 12/20 (60%)
 Frame = +3

Query: 228 IFFQTFKPSLDFYE*FKTKI 287
           +FF  +K  LD+Y  +K  +
Sbjct: 416 VFFSIYKTILDYYHKYKENL 435


>AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precursor
           protein.
          Length = 405

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 9/42 (21%), Positives = 17/42 (40%)
 Frame = +2

Query: 503 WSPGTATAPTTIDQISNKAFACAYSVTKPTHWELRTL*FVAT 628
           WS  T T  T +  I+       Y + +   W++  +  + T
Sbjct: 222 WSSKTETNATVLHSINKVIIHPKYDIIEKDDWQINDIALLKT 263


>AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.
          Length = 226

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 7/20 (35%), Positives = 12/20 (60%)
 Frame = +3

Query: 228 IFFQTFKPSLDFYE*FKTKI 287
           +FF  +K  LD+Y  +K  +
Sbjct: 42  VFFSIYKTILDYYHKYKENL 61


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 233,772
Number of Sequences: 438
Number of extensions: 5382
Number of successful extensions: 15
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26581563
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).