SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0026
         (744 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.   339   2e-95
EF032397-1|ABM97933.1|  200|Apis mellifera arginine kinase protein.   103   2e-24
AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamat...    24   1.7  
AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamat...    24   1.7  
AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C prot...    22   7.0  

>AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.
          Length = 355

 Score =  339 bits (833), Expect = 2e-95
 Identities = 156/188 (82%), Positives = 171/188 (90%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PLTGMSKETQQ+LIDDHFLFKEGDRF+QAANACRFWPTGRGIYHN++KTFLVWCNEEDHL
Sbjct: 168 PLTGMSKETQQKLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNDDKTFLVWCNEEDHL 227

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQMGGDL QVY+RLV AVNEIEK++ FSH+DRLGFLTFCPTNLGTTVRASVHI   
Sbjct: 228 RIISMQMGGDLGQVYRRLVHAVNEIEKRLLFSHNDRLGFLTFCPTNLGTTVRASVHIKLP 287

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                   LEE+A K++LQVRGTRGEHTEAEGG+YDISNKRR+GLTEY AVKEM+DGIAE
Sbjct: 288 KLAANRAKLEEIAGKFNLQVRGTRGEHTEAEGGIYDISNKRRLGLTEYQAVKEMHDGIAE 347

Query: 202 LIKIEKSL 179
           LIK+EK L
Sbjct: 348 LIKLEKEL 355


>EF032397-1|ABM97933.1|  200|Apis mellifera arginine kinase protein.
          Length = 200

 Score =  103 bits (247), Expect = 2e-24
 Identities = 44/49 (89%), Positives = 48/49 (97%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKT 596
           PLTGMSKETQQ+LIDDHFLFKEGDRF+QAANA RFWPTGRGIYHN++KT
Sbjct: 152 PLTGMSKETQQKLIDDHFLFKEGDRFLQAANAXRFWPTGRGIYHNDDKT 200


>AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamate
           receptor 1 protein.
          Length = 843

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%)
 Frame = +3

Query: 633 GQKRQALAAC-MKRSPSLNRKWSSMSCCWV 719
           G K   ++AC +   P + +K    +CCWV
Sbjct: 440 GTKDIPISACSLPCEPGMIKKQQGDTCCWV 469


>AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 933

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%)
 Frame = +3

Query: 633 GQKRQALAAC-MKRSPSLNRKWSSMSCCWV 719
           G K   ++AC +   P + +K    +CCWV
Sbjct: 530 GTKDIPISACSLPCEPGMIKKQQGDTCCWV 559


>AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C
           protein.
          Length = 149

 Score = 21.8 bits (44), Expect = 7.0
 Identities = 10/33 (30%), Positives = 18/33 (54%)
 Frame = -3

Query: 640 FWPTGRGIYHNENKTFLVWCNEEDHLRIISMQM 542
           F+  GRGI + + K   V  +++ H++I    M
Sbjct: 99  FFLHGRGIVYRDLKLDNVLLDQDGHIKIADFGM 131


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 139,647
Number of Sequences: 438
Number of extensions: 2587
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23266665
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).