SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0023
         (852 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ435336-1|ABD92651.1|  135|Apis mellifera OBP19 protein.              24   1.5  
AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly pro...    24   2.0  
AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly pro...    24   2.0  
DQ435337-1|ABD92652.1|  135|Apis mellifera OBP20 protein.              22   6.2  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       22   6.2  
DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    22   8.2  

>DQ435336-1|ABD92651.1|  135|Apis mellifera OBP19 protein.
          Length = 135

 Score = 24.2 bits (50), Expect = 1.5
 Identities = 10/31 (32%), Positives = 18/31 (58%)
 Frame = +1

Query: 358 LICLFAVVVIRGAWSIREIFIQLRLLDSCCR 450
           ++ +FA  +   A +I E+ IQLR +   C+
Sbjct: 4   IVVIFAFCICVNAMTIEELKIQLRDVQEICK 34


>AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly
           protein MRJP6 protein.
          Length = 437

 Score = 23.8 bits (49), Expect = 2.0
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = +1

Query: 748 NYKDQSGILSEMSLKTDK 801
           NYKD SGI+S   +  DK
Sbjct: 118 NYKDCSGIVSAYKIAIDK 135


>AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly
           protein MRJP5 protein.
          Length = 598

 Score = 23.8 bits (49), Expect = 2.0
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = +1

Query: 748 NYKDQSGILSEMSLKTDK 801
           NYKD SGI+S   +  DK
Sbjct: 118 NYKDCSGIVSAYKIAIDK 135


>DQ435337-1|ABD92652.1|  135|Apis mellifera OBP20 protein.
          Length = 135

 Score = 22.2 bits (45), Expect = 6.2
 Identities = 9/31 (29%), Positives = 17/31 (54%)
 Frame = +1

Query: 358 LICLFAVVVIRGAWSIREIFIQLRLLDSCCR 450
           ++ +FA  +   A +I E+ IQL  +   C+
Sbjct: 4   IVVIFAFCICVNAMTIEELKIQLHDVQEICK 34


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 22.2 bits (45), Expect = 6.2
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +2

Query: 575 WFEQHFCYF 601
           WF+  FCYF
Sbjct: 533 WFQNTFCYF 541


>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
           receptor beta1subunit protein.
          Length = 520

 Score = 21.8 bits (44), Expect = 8.2
 Identities = 12/54 (22%), Positives = 24/54 (44%)
 Frame = +2

Query: 74  TVVAALLLCSWQRRMPRTPECPMSTSDLVVKMFFFIA*MGGRAHSPPGVKWLPE 235
           +++  +++ +W  R PRT   P     + +K    I  M  R      ++W+ E
Sbjct: 310 SILVTVIIINWNFRGPRTHRMPQLIRKIFLKYLPTILMM--RRPKKTRLRWMME 361


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 239,794
Number of Sequences: 438
Number of extensions: 5528
Number of successful extensions: 13
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 27431202
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).