SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0020
         (788 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    23   3.2  
AB023025-1|BAA74592.1|  133|Apis mellifera actin protein.              23   3.2  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             23   4.3  
AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    22   5.7  
EF051030-1|ABN05618.1|  118|Apis mellifera phosphoenolpyruvate c...    21   9.9  
AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C prot...    21   9.9  

>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 10/26 (38%), Positives = 15/26 (57%)
 Frame = +1

Query: 358  LRVAPEEHPVLLTEAPLNPKANREKM 435
            LR+ P  H V+ T   +NP  + EK+
Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486


>AB023025-1|BAA74592.1|  133|Apis mellifera actin protein.
          Length = 133

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = +1

Query: 754 EMATAASSSSL 786
           EMATAASSSSL
Sbjct: 1   EMATAASSSSL 11


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 12/44 (27%), Positives = 21/44 (47%)
 Frame = +3

Query: 501 AVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRP 632
           ++  +++HR        C P   +L +I + P HP +  S S P
Sbjct: 62  SLTAQAHHRLYPAFSSSCDPVPGNLEQIGSRPLHPPAS-STSLP 104


>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 22.2 bits (45), Expect = 5.7
 Identities = 12/34 (35%), Positives = 12/34 (35%), Gaps = 1/34 (2%)
 Frame = +3

Query: 588 TP-PRHPASGLSRSRPHRLPHEDPHRARLLVHYH 686
           TP P H   G   S  H  PH     A    H H
Sbjct: 411 TPGPHHHTMGHGHSHIHATPHHHHSHAATPHHQH 444


>EF051030-1|ABN05618.1|  118|Apis mellifera phosphoenolpyruvate
           carboxykinase protein.
          Length = 118

 Score = 21.4 bits (43), Expect = 9.9
 Identities = 10/31 (32%), Positives = 15/31 (48%)
 Frame = -3

Query: 561 VGDTVAGVQHDTGGTTGRVQREHGLDGDVHG 469
           VGD +A ++ D  G    +  E+G  G   G
Sbjct: 42  VGDDIAWMKFDKEGRLRAINPEYGFFGVAPG 72


>AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C
           protein.
          Length = 149

 Score = 21.4 bits (43), Expect = 9.9
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +1

Query: 121 GMCKAGFAGD 150
           GMCK G +GD
Sbjct: 130 GMCKEGISGD 139


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 239,529
Number of Sequences: 438
Number of extensions: 5969
Number of successful extensions: 12
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24882285
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).