SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0018
         (929 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    25   0.74 
DQ435331-1|ABD92646.1|  135|Apis mellifera OBP14 protein.              23   3.9  
AY898652-1|AAX83121.1|  349|Apis mellifera AKH receptor protein.       23   5.2  
AF134818-1|AAD40234.1|  130|Apis mellifera lambda crystallin-lik...    22   9.1  
AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase pro...    22   9.1  

>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
           receptor beta1subunit protein.
          Length = 520

 Score = 25.4 bits (53), Expect = 0.74
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 3/42 (7%)
 Frame = +3

Query: 495 RALLQQPHTSGPNQTRAGSPHAIPK---TCQTKA*LETKGIS 611
           R +++ P+ + P  T +GSP  +PK   T  TK+ +E   +S
Sbjct: 357 RWMMEIPNVTLPTSTYSGSPTELPKHLPTSLTKSKMEVMELS 398


>DQ435331-1|ABD92646.1|  135|Apis mellifera OBP14 protein.
          Length = 135

 Score = 23.0 bits (47), Expect = 3.9
 Identities = 8/29 (27%), Positives = 16/29 (55%)
 Frame = +1

Query: 412 FLNCIATLTVQKVSLKL*TYRMFCSGDLG 498
           F  C+  LT++++  +L T +  C  + G
Sbjct: 10  FCVCVGALTIEELKTRLHTEQSVCKTETG 38


>AY898652-1|AAX83121.1|  349|Apis mellifera AKH receptor protein.
          Length = 349

 Score = 22.6 bits (46), Expect = 5.2
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = +3

Query: 720 CANVFCMHPILYGA 761
           C N  CM+PI+YGA
Sbjct: 306 CTNS-CMNPIVYGA 318


>AF134818-1|AAD40234.1|  130|Apis mellifera lambda crystallin-like
           protein protein.
          Length = 130

 Score = 21.8 bits (44), Expect = 9.1
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = +2

Query: 443 KKFH*NYKHIVCSVQVTSGPPP 508
           KK+   YK+ +  V +T GP P
Sbjct: 64  KKYCETYKNSIYDVSMTFGPVP 85


>AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase
           protein.
          Length = 580

 Score = 21.8 bits (44), Expect = 9.1
 Identities = 8/23 (34%), Positives = 15/23 (65%)
 Frame = -3

Query: 828 FAHNICFRTTTTLKSDRVIASSS 760
           ++H + F++ + LK   VIA+ S
Sbjct: 463 YSHYVAFKSLSYLKKQPVIANGS 485


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 273,870
Number of Sequences: 438
Number of extensions: 6227
Number of successful extensions: 8
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 30355689
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).