SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0016
         (985 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY897570-1|AAW81036.1|  223|Apis mellifera venom protein 2 protein.    27   0.26 
DQ485319-1|ABF21078.1|  175|Apis mellifera icarapin variant 2 pr...    25   0.79 
DQ485318-1|ABF21077.1|  223|Apis mellifera icarapin variant 1 pr...    25   0.79 
AY939856-1|AAX33236.1|  223|Apis mellifera venom carbohydrate-ri...    25   0.79 
DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex det...    25   1.4  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    25   1.4  
DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex det...    24   2.4  
DQ325104-1|ABD14118.1|  180|Apis mellifera complementary sex det...    23   3.2  
DQ325132-1|ABD14146.1|  189|Apis mellifera complementary sex det...    23   4.2  
DQ325131-1|ABD14145.1|  189|Apis mellifera complementary sex det...    23   4.2  
AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex det...    23   4.2  
AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat...    22   7.4  
DQ667183-1|ABG75735.1|  463|Apis mellifera GABA-gated ion channe...    22   9.8  
DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex det...    22   9.8  
DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex det...    22   9.8  
DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex det...    22   9.8  
DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex det...    22   9.8  
DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex det...    22   9.8  
AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex det...    22   9.8  

>AY897570-1|AAW81036.1|  223|Apis mellifera venom protein 2 protein.
          Length = 223

 Score = 27.1 bits (57), Expect = 0.26
 Identities = 19/75 (25%), Positives = 32/75 (42%), Gaps = 4/75 (5%)
 Frame = +2

Query: 734 AINETTRRTPKDDLSNDIETLLVEIR----DVQTRLTDLPDESLEATEEVSRRESNFNQV 901
           AINETT     DD S  I   ++++R     + T ++   D  +     +  +     Q 
Sbjct: 140 AINETTYTDGSDDYSTLIRVRVIDVRPQNETILTTVSSEADSDVTTLPTLIGKNETSTQS 199

Query: 902 RRSSRAVGAEDHGVP 946
            RS  +V   D+ +P
Sbjct: 200 SRSVESVEDFDNEIP 214


>DQ485319-1|ABF21078.1|  175|Apis mellifera icarapin variant 2
           precursor protein.
          Length = 175

 Score = 25.4 bits (53), Expect = 0.79
 Identities = 18/74 (24%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
 Frame = +2

Query: 737 INETTRRTPKDDLSNDIETLLVEIR----DVQTRLTDLPDESLEATEEVSRRESNFNQVR 904
           INETT     DD S  I   ++++R     + T ++   D  +     +  +     Q  
Sbjct: 93  INETTYTDGSDDYSTLIRVRVIDVRPQNETILTTVSSEADSDVTTLPTLIGKNETSTQSS 152

Query: 905 RSSRAVGAEDHGVP 946
           RS  +V   D+ +P
Sbjct: 153 RSVESVEDFDNEIP 166


>DQ485318-1|ABF21077.1|  223|Apis mellifera icarapin variant 1
           precursor protein.
          Length = 223

 Score = 25.4 bits (53), Expect = 0.79
 Identities = 18/74 (24%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
 Frame = +2

Query: 737 INETTRRTPKDDLSNDIETLLVEIR----DVQTRLTDLPDESLEATEEVSRRESNFNQVR 904
           INETT     DD S  I   ++++R     + T ++   D  +     +  +     Q  
Sbjct: 141 INETTYTDGSDDYSTLIRVRVIDVRPQNETILTTVSSEADSDVTTLPTLIGKNETSTQSS 200

Query: 905 RSSRAVGAEDHGVP 946
           RS  +V   D+ +P
Sbjct: 201 RSVESVEDFDNEIP 214


>AY939856-1|AAX33236.1|  223|Apis mellifera venom carbohydrate-rich
           protein precursor protein.
          Length = 223

 Score = 25.4 bits (53), Expect = 0.79
 Identities = 18/74 (24%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
 Frame = +2

Query: 737 INETTRRTPKDDLSNDIETLLVEIR----DVQTRLTDLPDESLEATEEVSRRESNFNQVR 904
           INETT     DD S  I   ++++R     + T ++   D  +     +  +     Q  
Sbjct: 141 INETTYTDGSDDYSTLIRVRVIDVRPQNETILTTVSSEADSDVTTLPTLIGKNETSTQSS 200

Query: 905 RSSRAVGAEDHGVP 946
           RS  +V   D+ +P
Sbjct: 201 RSVESVEDFDNEIP 214


>DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex
           determiner protein.
          Length = 191

 Score = 24.6 bits (51), Expect = 1.4
 Identities = 14/46 (30%), Positives = 23/46 (50%)
 Frame = +2

Query: 44  ENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKPDNFWINKY 181
           +  ERE + EP++  +LS+    N  +   NN+ N   +N   N Y
Sbjct: 69  DRTERERSREPKIISSLSNKTIHNNNNYNNNNYNNYNYNNNNYNNY 114


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 24.6 bits (51), Expect = 1.4
 Identities = 14/46 (30%), Positives = 25/46 (54%)
 Frame = +2

Query: 44  ENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKPDNFWINKY 181
           +  ERE + EP++  +LS+   I+  +   NN+ N   +N+  N Y
Sbjct: 302 DRTERERSREPKIISSLSNKT-IHNNNNYNNNNYNNNYNNYNNNNY 346


>DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.8 bits (49), Expect = 2.4
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = +2

Query: 44  ENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKPDNFWIN 175
           +  ERE + EP++  +LS+    N  +   NN+ N K   + IN
Sbjct: 69  DRTERERSREPKIISSLSNKTIHNNNNYNNNNYNNYKKLYYNIN 112


>DQ325104-1|ABD14118.1|  180|Apis mellifera complementary sex
           determiner protein.
          Length = 180

 Score = 23.4 bits (48), Expect = 3.2
 Identities = 12/40 (30%), Positives = 22/40 (55%)
 Frame = +2

Query: 251 KQNQPKEKPIDLNLKTDVKVDIENIRNDNKFWVEKHLYHD 370
           ++ + KE+ I  +L  +   +I N  NDN +   K LY++
Sbjct: 72  ERERSKERKIISSLSNNYISNISNYNNDNNY--NKKLYYN 109


>DQ325132-1|ABD14146.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 23.0 bits (47), Expect = 4.2
 Identities = 11/41 (26%), Positives = 22/41 (53%)
 Frame = +2

Query: 44  ENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKPDNF 166
           +  ERE + EP++  +LS+    +  +   NN+ N   +N+
Sbjct: 69  DRTERETSKEPKIISSLSNNYKYSNYNNYNNNYNNNYNNNY 109


>DQ325131-1|ABD14145.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 23.0 bits (47), Expect = 4.2
 Identities = 11/41 (26%), Positives = 22/41 (53%)
 Frame = +2

Query: 44  ENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKPDNF 166
           +  ERE + EP++  +LS+    +  +   NN+ N   +N+
Sbjct: 69  DRTERETSKEPKIISSLSNNYKYSNYNNYNNNYNNNYNNNY 109


>AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex
           determiner protein.
          Length = 425

 Score = 23.0 bits (47), Expect = 4.2
 Identities = 13/47 (27%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = +2

Query: 44  ENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKP-DNFWINKY 181
           +  ERE + EP++  +LS+    +  +   NN+ N    +N + N Y
Sbjct: 302 DRTERERSKEPKIISSLSNNYKYSNYNNYNNNYNNYNNYNNNYNNNY 348


>AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate
            receptor protein.
          Length = 1040

 Score = 22.2 bits (45), Expect = 7.4
 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 7/47 (14%)
 Frame = +2

Query: 347  VEKHLYHDAEC----QYF---LSMAKKSKPTSAVGDDFEVKDQNDKD 466
            V+KH+    +C    +Y+   +   K  KP S V    +    NDKD
Sbjct: 955  VKKHITTTIDCSTQSEYYELEVKDQKNGKPPSVVSRSTQTSANNDKD 1001


>DQ667183-1|ABG75735.1|  463|Apis mellifera GABA-gated ion channel
           protein.
          Length = 463

 Score = 21.8 bits (44), Expect = 9.8
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = +2

Query: 701 PVVQTPPLQEPAINETTRRTPK 766
           P  QTPP ++ +     RRTP+
Sbjct: 395 PPRQTPPSRKESGRRRRRRTPR 416


>DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.8 bits (44), Expect = 9.8
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = +2

Query: 53  EREETIEPELSDTLSDAVPINVVDPITNNHIN 148
           ERE + EP++  +LS+    +  +   NN+ N
Sbjct: 72  ERERSKEPKIISSLSNNYKYSNYNNYNNNNYN 103


>DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.8 bits (44), Expect = 9.8
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = +2

Query: 53  EREETIEPELSDTLSDAVPINVVDPITNNHIN 148
           ERE + EP++  +LS+    +  +   NN+ N
Sbjct: 72  ERERSKEPKIISSLSNNYKYSNYNNYNNNNYN 103


>DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.8 bits (44), Expect = 9.8
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = +2

Query: 53  EREETIEPELSDTLSDAVPINVVDPITNNHIN 148
           ERE + EP++  +LS+    +  +   NN+ N
Sbjct: 72  ERERSKEPKIISSLSNNYKYSNYNNYNNNNYN 103


>DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.8 bits (44), Expect = 9.8
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = +2

Query: 53  EREETIEPELSDTLSDAVPINVVDPITNNHIN 148
           ERE + EP++  +LS+    +  +   NN+ N
Sbjct: 72  ERERSKEPKIISSLSNNYKYSNYNNYNNNNYN 103


>DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 21.8 bits (44), Expect = 9.8
 Identities = 10/35 (28%), Positives = 19/35 (54%)
 Frame = +2

Query: 44  ENVEREETIEPELSDTLSDAVPINVVDPITNNHIN 148
           +  ERE + EP++  +LS+    +  +   NN+ N
Sbjct: 69  DRTERERSREPKIISSLSNNYNYSNYNNYNNNYNN 103


>AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex
           determiner protein.
          Length = 418

 Score = 21.8 bits (44), Expect = 9.8
 Identities = 11/37 (29%), Positives = 20/37 (54%)
 Frame = +2

Query: 44  ENVEREETIEPELSDTLSDAVPINVVDPITNNHINLK 154
           +  ERE + E ++  +LS+    N+ +   NN+ N K
Sbjct: 307 DKTERERSKERKIISSLSNNYISNISNYNNNNNYNKK 343


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 240,708
Number of Sequences: 438
Number of extensions: 4882
Number of successful extensions: 36
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 35
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 32532591
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).