SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0013
         (823 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle pr...    23   2.6  
DQ468657-1|ABE02558.1|  322|Apis mellifera 1,4,5-trisphosphate r...    23   2.6  
AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.     23   3.4  
AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase...    22   6.0  

>EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle
           protein protein.
          Length = 138

 Score = 23.4 bits (48), Expect = 2.6
 Identities = 9/33 (27%), Positives = 18/33 (54%)
 Frame = +3

Query: 705 EEVC*SAYSKSNPWQVRGGSTGVPPPAPPALEQ 803
           ++V  +  +  N +QV+G      PP PP +++
Sbjct: 83  QQVSITYVADENGFQVQGSHIPTAPPIPPEIQR 115


>DQ468657-1|ABE02558.1|  322|Apis mellifera 1,4,5-trisphosphate
           receptor protein.
          Length = 322

 Score = 23.4 bits (48), Expect = 2.6
 Identities = 11/26 (42%), Positives = 14/26 (53%)
 Frame = +1

Query: 571 HGRRPGKNRRDRERKAPPRAHKTPQQ 648
           HG +  KN+ D +  A PR  K P Q
Sbjct: 209 HGNKKKKNKEDEDDGATPR--KAPPQ 232


>AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.
          Length = 388

 Score = 23.0 bits (47), Expect = 3.4
 Identities = 7/25 (28%), Positives = 17/25 (68%)
 Frame = +3

Query: 33  IRVFHHKQHFLSIDTIRALYSVLKK 107
           I +FH   +F++++T  ++YS  ++
Sbjct: 179 IHLFHDASNFIAMETFPSVYSKTRR 203


>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
           protein.
          Length = 1143

 Score = 22.2 bits (45), Expect = 6.0
 Identities = 9/32 (28%), Positives = 15/32 (46%), Gaps = 1/32 (3%)
 Frame = +3

Query: 306 PTWPVEAWMRARD-RFTARSARPDLYKRQRRR 398
           P W    W + RD + T++  R   + +Q  R
Sbjct: 420 PAWKTHVWKKGRDKKSTSKKPRRKFHFKQIAR 451


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 222,796
Number of Sequences: 438
Number of extensions: 4683
Number of successful extensions: 16
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26217432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).