SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0011
         (939 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             26   0.43 
EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     23   5.3  
AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase pro...    22   9.2  

>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 26.2 bits (55), Expect = 0.43
 Identities = 12/45 (26%), Positives = 22/45 (48%)
 Frame = +1

Query: 352 SQALPAYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEE 486
           +QA P    +    +P +   Q + +Q Q + P   DD + ++EE
Sbjct: 826 AQAQPQQQQQQQQQQPQQQQQQQQQQQQQQRGPMTNDDFNPNIEE 870


>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 22.6 bits (46), Expect = 5.3
 Identities = 9/23 (39%), Positives = 11/23 (47%)
 Frame = +1

Query: 490 ENMDLRENIANLITVMCEITFDP 558
           +N  LRE +A   T  C    DP
Sbjct: 35  DNPSLREGLAGASTFRCVFVLDP 57



 Score = 22.6 bits (46), Expect = 5.3
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = +2

Query: 803 WKLQRRICVDLLCSLPRLYSALRIVKEEE*DSR*SLCK 916
           W+   +   DL CSL +L S L +++ +  D+   L K
Sbjct: 70  WRFLLQCLEDLDCSLRKLNSRLFVIRGQPADALPKLFK 107


>AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase
           protein.
          Length = 580

 Score = 21.8 bits (44), Expect = 9.2
 Identities = 6/16 (37%), Positives = 12/16 (75%)
 Frame = +2

Query: 275 QTNQRWILLNRSYQQM 322
           QTN+ W+ +N +Y+ +
Sbjct: 438 QTNKTWLPVNENYKSL 453


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 272,755
Number of Sequences: 438
Number of extensions: 6323
Number of successful extensions: 13
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 30718506
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).