SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0009
         (585 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alp...    24   1.3  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    23   1.7  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    23   1.7  
AM420631-1|CAM06631.1|  153|Apis mellifera bursicon subunit alph...    21   6.7  
AY375535-1|AAQ82648.1|  147|Apis mellifera doublesex protein.          21   8.9  
AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate r...    21   8.9  

>X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alpha
           protein.
          Length = 461

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 1/50 (2%)
 Frame = -3

Query: 577 RFQMGREY-TSGPAAGHKSRRLVDRSPDGVDKADCRVVDPLRGVGVLNCG 431
           +F+  + Y T   A GH  R  +     G  +ADC V+    G+G    G
Sbjct: 79  KFETAKYYVTIIDAPGH--RDFIKNMITGTSQADCAVLIVAAGIGEFEAG 126


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 23.4 bits (48), Expect = 1.7
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = -2

Query: 77   GCRNSGPVLCPRGENQAPGV 18
            G   S PVL  R + QAPG+
Sbjct: 1482 GSSPSSPVLSVRTQGQAPGI 1501


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 23.4 bits (48), Expect = 1.7
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = -2

Query: 77   GCRNSGPVLCPRGENQAPGV 18
            G   S PVL  R + QAPG+
Sbjct: 1478 GSSPSSPVLSVRTQGQAPGI 1497


>AM420631-1|CAM06631.1|  153|Apis mellifera bursicon subunit alpha
           protein precursor protein.
          Length = 153

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 9/17 (52%), Positives = 9/17 (52%)
 Frame = +3

Query: 498 SGERSTRRRLLCPAAGP 548
           SGER     L CP A P
Sbjct: 81  SGEREASVSLFCPRAKP 97


>AY375535-1|AAQ82648.1|  147|Apis mellifera doublesex protein.
          Length = 147

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 7/14 (50%), Positives = 8/14 (57%)
 Frame = +1

Query: 325 SPYPGHTGNGAHPG 366
           SP   H+ NG H G
Sbjct: 74  SPVSSHSSNGIHTG 87


>AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate
           receptor 1 protein.
          Length = 953

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 12/39 (30%), Positives = 17/39 (43%)
 Frame = +2

Query: 35  FHPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVG 151
           F P    ++ N D      +   +A   AWG  LNS +G
Sbjct: 589 FSPFGRFKLANTDGTEEDALNLSSAVWFAWGVLLNSGIG 627


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 181,791
Number of Sequences: 438
Number of extensions: 4793
Number of successful extensions: 29
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 16993167
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).