SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0006
         (852 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     24   2.0  
AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    22   8.2  
AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex det...    22   8.2  

>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 23.8 bits (49), Expect = 2.0
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = +3

Query: 327 KKNLRPQ-FIPTFLILNVYVREPCLSLYFFGWQQSIQQSYLKKKTP 461
           +  + PQ  +P+   L+ Y+R  CLS   F +Q +     +KK  P
Sbjct: 254 RPKMTPQSLLPSQTGLSPYLRFGCLSTRLFYYQLTDLYKKIKKAVP 299


>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 21.8 bits (44), Expect = 8.2
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = +2

Query: 710 VARDDTRGERRGGPTDRGFD 769
           VA+    GER+ G  D G+D
Sbjct: 473 VAQAQLGGERQNGRKDSGYD 492


>AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex
           determiner protein.
          Length = 425

 Score = 21.8 bits (44), Expect = 8.2
 Identities = 9/28 (32%), Positives = 16/28 (57%)
 Frame = -1

Query: 255 NEHFNNVYQHLFIYLSNFLFLFYLINIV 172
           N ++NN   +   Y +N+  L+Y IN +
Sbjct: 331 NNNYNNYNNYNNNYNNNYKKLYYNINYI 358


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 214,475
Number of Sequences: 438
Number of extensions: 4295
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 27431202
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).