SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0004
         (717 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB023025-1|BAA74592.1|  133|Apis mellifera actin protein.             261   4e-72
DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450 monoo...    25   0.71 
EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.          22   6.7  
EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.      22   6.7  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    21   8.8  

>AB023025-1|BAA74592.1|  133|Apis mellifera actin protein.
          Length = 133

 Score =  261 bits (640), Expect = 4e-72
 Identities = 122/123 (99%), Positives = 123/123 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA
Sbjct: 11  LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 70

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPE+KYSVWIGGSILASLSTFQQM
Sbjct: 71  NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWIGGSILASLSTFQQM 130

Query: 346 WIS 338
           WIS
Sbjct: 131 WIS 133


>DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 499

 Score = 25.0 bits (52), Expect = 0.71
 Identities = 21/62 (33%), Positives = 30/62 (48%)
 Frame = -3

Query: 574 NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 395
           N  +K D DI++  Y + V      MYP  +  M+K I+    +  KI I  P E K  +
Sbjct: 342 NKELKYD-DIKEMEYLDKVFKETLRMYPPASILMRKAISDYTFNDTKITI--PKEMK--I 396

Query: 394 WI 389
           WI
Sbjct: 397 WI 398


>EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.
          Length = 684

 Score = 21.8 bits (44), Expect = 6.7
 Identities = 7/18 (38%), Positives = 12/18 (66%)
 Frame = -2

Query: 521 RIVRWYHHVPWNRRPYAK 468
           RI+ +YH    +++PY K
Sbjct: 424 RIIDYYHSYKMHQKPYNK 441


>EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.
          Length = 684

 Score = 21.8 bits (44), Expect = 6.7
 Identities = 7/18 (38%), Positives = 12/18 (66%)
 Frame = -2

Query: 521 RIVRWYHHVPWNRRPYAK 468
           RI+ +YH    +++PY K
Sbjct: 424 RIIDYYHSYKMHQKPYNK 441


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 10/37 (27%), Positives = 19/37 (51%)
 Frame = -3

Query: 625 QPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           + +FLG+    +   +YN +   D  + KDL+   +L
Sbjct: 328 ETTFLGLIRLIVLNLSYNMLTHIDARMFKDLFFLQIL 364


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 206,994
Number of Sequences: 438
Number of extensions: 4588
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22170330
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).