SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0003
         (841 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          25   1.1  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      25   1.1  
AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.          25   1.1  
AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex det...    22   6.1  

>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 24.6 bits (51), Expect = 1.1
 Identities = 7/16 (43%), Positives = 14/16 (87%)
 Frame = +3

Query: 168 EFDEYGYEQDHIHHHM 215
           ++DE+G+E D +H++M
Sbjct: 521 KYDEFGHEVDLVHNYM 536



 Score = 21.8 bits (44), Expect = 8.1
 Identities = 9/34 (26%), Positives = 17/34 (50%)
 Frame = -3

Query: 656 DKMIKMRLSLTFSY*GQSKINYNNTTFQLLLSNY 555
           D++++   ++        K  YNN  + LL +NY
Sbjct: 171 DEVMQKAYNIAMGDTADMKKTYNNIDYYLLAANY 204


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 24.6 bits (51), Expect = 1.1
 Identities = 7/16 (43%), Positives = 14/16 (87%)
 Frame = +3

Query: 168 EFDEYGYEQDHIHHHM 215
           ++DE+G+E D +H++M
Sbjct: 521 KYDEFGHEVDLVHNYM 536



 Score = 21.8 bits (44), Expect = 8.1
 Identities = 9/34 (26%), Positives = 17/34 (50%)
 Frame = -3

Query: 656 DKMIKMRLSLTFSY*GQSKINYNNTTFQLLLSNY 555
           D++++   ++        K  YNN  + LL +NY
Sbjct: 171 DEVMQKAYNIAMGDTADMKKTYNNIDYYLLAANY 204


>AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.
          Length = 226

 Score = 24.6 bits (51), Expect = 1.1
 Identities = 7/16 (43%), Positives = 14/16 (87%)
 Frame = +3

Query: 168 EFDEYGYEQDHIHHHM 215
           ++DE+G+E D +H++M
Sbjct: 147 KYDEFGHEVDLVHNYM 162


>AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex
           determiner protein.
          Length = 413

 Score = 22.2 bits (45), Expect = 6.1
 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 1/38 (2%)
 Frame = -3

Query: 656 DKMIKMRLSLTFSY*GQS-KINYNNTTFQLLLSNYFFS 546
           ++ I   LS  ++Y   + K NYNN   +L   NY  +
Sbjct: 311 ERKIISSLSNNYNYNNNNYKYNYNNYNKKLYYKNYIIN 348


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 175,463
Number of Sequences: 438
Number of extensions: 2992
Number of successful extensions: 10
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26945694
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).