SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0044
         (613 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride...    21   7.2  
DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride...    21   7.2  
DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride...    21   7.2  
DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride...    21   7.2  
AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex det...    21   7.2  
AF004169-1|AAC13418.1|  371|Apis mellifera ultraviolet-sensitive...    21   7.2  

>DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride
           channel variant 4 protein.
          Length = 489

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 11/34 (32%), Positives = 14/34 (41%)
 Frame = -2

Query: 345 FDDPVRPLHTVTDEREKNTTLYLKYRVFIIENNG 244
           F DP+ P+H         T  YL  R  I+   G
Sbjct: 155 FKDPLIPVHFALRIYRNGTVNYLMRRHLILSCQG 188


>DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride
           channel variant 3 protein.
          Length = 475

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 11/34 (32%), Positives = 14/34 (41%)
 Frame = -2

Query: 345 FDDPVRPLHTVTDEREKNTTLYLKYRVFIIENNG 244
           F DP+ P+H         T  YL  R  I+   G
Sbjct: 155 FKDPLIPVHFALRIYRNGTVNYLMRRHLILSCQG 188


>DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride
           channel variant 1 protein.
          Length = 509

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 11/34 (32%), Positives = 14/34 (41%)
 Frame = -2

Query: 345 FDDPVRPLHTVTDEREKNTTLYLKYRVFIIENNG 244
           F DP+ P+H         T  YL  R  I+   G
Sbjct: 206 FKDPLIPVHFALRIYRNGTVNYLMRRHLILSCQG 239


>DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride
           channel protein.
          Length = 458

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 11/34 (32%), Positives = 14/34 (41%)
 Frame = -2

Query: 345 FDDPVRPLHTVTDEREKNTTLYLKYRVFIIENNG 244
           F DP+ P+H         T  YL  R  I+   G
Sbjct: 155 FKDPLIPVHFALRIYRNGTVNYLMRRHLILSCQG 188


>AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = +3

Query: 495 NMLQYRKYELCLVRVF*LLRDRERYKNSQ 581
           N  +YRKY       F   R+RER K S+
Sbjct: 285 NEREYRKYRETSKERFRDRRERERSKESK 313


>AF004169-1|AAC13418.1|  371|Apis mellifera ultraviolet-sensitive
           opsin protein.
          Length = 371

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +1

Query: 163 SP*LHHLLYYIYIMNTHL 216
           +P LH+LL  +YI+ T L
Sbjct: 44  NPSLHYLLALLYILFTFL 61


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 162,595
Number of Sequences: 438
Number of extensions: 3538
Number of successful extensions: 7
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18093444
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).