SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0039
         (616 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.     25   0.59 
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        23   1.8  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        23   1.8  
AY263366-1|AAO92605.1|  139|Apis mellifera octopamine receptor p...    23   1.8  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        23   1.8  
AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor p...    23   1.8  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    23   2.4  
AB073998-1|BAC76402.1|  339|Apis mellifera preprotachykinin prot...    23   2.4  
AB073995-1|BAC76399.1|  301|Apis mellifera preprotachykinin prot...    23   2.4  
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    22   4.1  
DQ325130-1|ABD14144.1|  174|Apis mellifera complementary sex det...    22   5.5  
DQ325129-1|ABD14143.1|  174|Apis mellifera complementary sex det...    22   5.5  
DQ325128-1|ABD14142.1|  174|Apis mellifera complementary sex det...    22   5.5  
DQ325127-1|ABD14141.1|  174|Apis mellifera complementary sex det...    22   5.5  
DQ325125-1|ABD14139.1|  174|Apis mellifera complementary sex det...    22   5.5  
DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex det...    22   5.5  
DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex det...    22   5.5  
DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex det...    22   5.5  
DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex det...    22   5.5  
DQ325109-1|ABD14123.1|  177|Apis mellifera complementary sex det...    22   5.5  
DQ325108-1|ABD14122.1|  177|Apis mellifera complementary sex det...    22   5.5  
DQ325107-1|ABD14121.1|  176|Apis mellifera complementary sex det...    22   5.5  
DQ325106-1|ABD14120.1|  177|Apis mellifera complementary sex det...    22   5.5  
DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex det...    22   5.5  
DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex det...    22   5.5  
DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex det...    22   5.5  
DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex det...    22   5.5  
DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex det...    22   5.5  
DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex det...    22   5.5  
DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex det...    22   5.5  
DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex det...    22   5.5  
DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex det...    22   5.5  
DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex det...    22   5.5  
DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex det...    22   5.5  
DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex det...    22   5.5  
DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex det...    22   5.5  
AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex det...    22   5.5  
AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex det...    22   5.5  
AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C prot...    21   7.2  
EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          21   9.6  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      21   9.6  
AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    21   9.6  
AB086196-1|BAD06465.1|  289|Apis mellifera Period protein.             21   9.6  

>AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.
          Length = 388

 Score = 25.0 bits (52), Expect = 0.59
 Identities = 16/45 (35%), Positives = 21/45 (46%)
 Frame = -2

Query: 294 GSGYLFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISC 160
           GS Y+   VP    RVLL+ TD   +    S D  E+G     +C
Sbjct: 329 GSNYMQTRVPAWCDRVLLNPTDKMLVQDISSPDAVEYGIIGPTTC 373


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 23.4 bits (48), Expect = 1.8
 Identities = 11/35 (31%), Positives = 16/35 (45%)
 Frame = -1

Query: 286 IPLLLCASSPTKSPSVPYRPSRPDGGAFPRSRGTR 182
           +P+ + A+ PT      YR   PDG   P    T+
Sbjct: 265 LPVGVTAAIPTSENPADYRYFCPDGSKVPIDANTK 299


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 23.4 bits (48), Expect = 1.8
 Identities = 11/35 (31%), Positives = 16/35 (45%)
 Frame = -1

Query: 286 IPLLLCASSPTKSPSVPYRPSRPDGGAFPRSRGTR 182
           +P+ + A+ PT      YR   PDG   P    T+
Sbjct: 265 LPVGVTAAIPTSENPADYRYFCPDGSKVPIDANTK 299


>AY263366-1|AAO92605.1|  139|Apis mellifera octopamine receptor
           protein.
          Length = 139

 Score = 23.4 bits (48), Expect = 1.8
 Identities = 13/43 (30%), Positives = 16/43 (37%), Gaps = 2/43 (4%)
 Frame = +3

Query: 489 MYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPC--PILRKGFR 611
           MY+    C  C  P V  V  W        +PC   +  K FR
Sbjct: 28  MYLVRAFCRNCIHPTVFSVLFWLGYCNSAINPCIYALFSKDFR 70


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 23.4 bits (48), Expect = 1.8
 Identities = 11/35 (31%), Positives = 16/35 (45%)
 Frame = -1

Query: 286 IPLLLCASSPTKSPSVPYRPSRPDGGAFPRSRGTR 182
           +P+ + A+ PT      YR   PDG   P    T+
Sbjct: 265 LPVGVTAAIPTSENPADYRYFCPDGSKVPIDANTK 299


>AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor
           protein.
          Length = 587

 Score = 23.4 bits (48), Expect = 1.8
 Identities = 13/43 (30%), Positives = 16/43 (37%), Gaps = 2/43 (4%)
 Frame = +3

Query: 489 MYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPC--PILRKGFR 611
           MY+    C  C  P V  V  W        +PC   +  K FR
Sbjct: 476 MYLVRAFCRNCIHPTVFSVLFWLGYCNSAINPCIYALFSKDFR 518


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 10/26 (38%), Positives = 15/26 (57%)
 Frame = +3

Query: 375  LRVAPEEHPVLLTEAPLNPKANREKM 452
            LR+ P  H V+ T   +NP  + EK+
Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486


>AB073998-1|BAC76402.1|  339|Apis mellifera preprotachykinin
           protein.
          Length = 339

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 13/45 (28%), Positives = 21/45 (46%)
 Frame = +3

Query: 204 KAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDD 338
           K  P G  G  G + +L   E   KRG++  +  ++    T +DD
Sbjct: 180 KRAPMGFYGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDD 224


>AB073995-1|BAC76399.1|  301|Apis mellifera preprotachykinin
           protein.
          Length = 301

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 13/45 (28%), Positives = 21/45 (46%)
 Frame = +3

Query: 204 KAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDD 338
           K  P G  G  G + +L   E   KRG++  +  ++    T +DD
Sbjct: 180 KRAPMGFYGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDD 224


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = +1

Query: 472 HSTRPPCTSPSKRALA 519
           H T PP  SPS +A A
Sbjct: 674 HLTSPPARSPSSQAQA 689


>DQ325130-1|ABD14144.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 141 FRHIGPSTPFPRF---IPP 156


>DQ325129-1|ABD14143.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 141 FRHIGPSTPFPRF---IPP 156


>DQ325128-1|ABD14142.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 141 FRHIGPSTPFPRF---IPP 156


>DQ325127-1|ABD14141.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 141 FRHIGPSTPFPRF---IPP 156


>DQ325125-1|ABD14139.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 141 FRHIGPSTPFPRF---IPP 156


>DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 152 FRHIGPSTPFPRF---IPP 167


>DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 152 FRHIGPSTPFPRF---IPP 167


>DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 152 FRHIGPSTPFPRF---IPP 167


>DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 152 FRHIGPSTPFPRF---IPP 167


>DQ325109-1|ABD14123.1|  177|Apis mellifera complementary sex
           determiner protein.
          Length = 177

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 144 FRHIGPSTPFPRF---IPP 159


>DQ325108-1|ABD14122.1|  177|Apis mellifera complementary sex
           determiner protein.
          Length = 177

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 144 FRHIGPSTPFPRF---IPP 159


>DQ325107-1|ABD14121.1|  176|Apis mellifera complementary sex
           determiner protein.
          Length = 176

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 144 FRHIGPSTPFPRF---IPP 159


>DQ325106-1|ABD14120.1|  177|Apis mellifera complementary sex
           determiner protein.
          Length = 177

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 144 FRHIGPSTPFPRF---IPP 159


>DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 150 FRHIGPSTPFPQF---IPP 165


>DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 150 FRHIGPSTPFPRF---IPP 165


>DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 150 FRHIGPSTPFPRF---IPP 165


>DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 150 FRHIGPSTPFPRF---IPP 165


>DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 150 FRHIGPSTPFPRF---IPP 165


>DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 150 FRHIGPSTPFPRF---IPP 165


>DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 150 FRHIGPSTPFPRF---IPP 165


>DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 150 FRHIGPSTPFPRF---IPP 165


>DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 147 FRHIGPSTPFPRF---IPP 162


>DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 147 FRHIGPSTPFPRF---IPP 162


>DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 147 FRHIGPSTPFPRF---IPP 162


>DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 147 FRHIGPSTPFPRF---IPP 162


>DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex
           determiner protein.
          Length = 186

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 153 FRHIGPSTPFPRF---IPP 168


>AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex
           determiner protein.
          Length = 425

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 392 FRHIGPSTPFPRF---IPP 407


>AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex
           determiner protein.
          Length = 410

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 11/19 (57%), Positives = 11/19 (57%)
 Frame = +2

Query: 557 FRRRGSSTPVPHFTKGIPP 613
           FR  G STP P F   IPP
Sbjct: 377 FRHIGPSTPFPRF---IPP 392


>AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C
           protein.
          Length = 149

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +1

Query: 139 GMCKAGFAGD 168
           GMCK G +GD
Sbjct: 130 GMCKEGISGD 139


>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 21.0 bits (42), Expect = 9.6
 Identities = 7/26 (26%), Positives = 16/26 (61%)
 Frame = -2

Query: 615 SGGIPFVKWGTGVEDPRRRKSSTIPV 538
           +G  P +++  G+  P+R   +T+P+
Sbjct: 292 TGYYPTMRFRNGLAFPQRETGATVPL 317


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 21.0 bits (42), Expect = 9.6
 Identities = 7/26 (26%), Positives = 16/26 (61%)
 Frame = -2

Query: 615 SGGIPFVKWGTGVEDPRRRKSSTIPV 538
           +G  P +++  G+  P+R   +T+P+
Sbjct: 292 TGYYPTMRFRNGLAFPQRETGATVPL 317


>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 21.0 bits (42), Expect = 9.6
 Identities = 8/18 (44%), Positives = 10/18 (55%)
 Frame = -2

Query: 198 DRGEHGARSIISCETGLA 145
           D GEH   ++   E GLA
Sbjct: 130 DPGEHNGDTVTDVEAGLA 147


>AB086196-1|BAD06465.1|  289|Apis mellifera Period protein.
          Length = 289

 Score = 21.0 bits (42), Expect = 9.6
 Identities = 8/18 (44%), Positives = 10/18 (55%)
 Frame = -2

Query: 198 DRGEHGARSIISCETGLA 145
           D GEH   ++   E GLA
Sbjct: 125 DPGEHNGDTVTDVEAGLA 142


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 199,162
Number of Sequences: 438
Number of extensions: 4950
Number of successful extensions: 46
Number of sequences better than 10.0: 43
Number of HSP's better than 10.0 without gapping: 46
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18215697
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).