SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0038
         (638 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride c...    23   3.3  
DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride c...    23   3.3  
AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl sub...    23   3.3  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    22   5.8  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    22   5.8  
AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cycl...    21   7.6  
AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cycl...    21   7.6  

>DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 7/23 (30%), Positives = 14/23 (60%)
 Frame = +2

Query: 518 FISEWIVDLVDWNQIYLLRNSTP 586
           +I   ++ ++ W   +L RN+TP
Sbjct: 228 YIPSGLIVIISWVSFWLNRNATP 250


>DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 7/23 (30%), Positives = 14/23 (60%)
 Frame = +2

Query: 518 FISEWIVDLVDWNQIYLLRNSTP 586
           +I   ++ ++ W   +L RN+TP
Sbjct: 228 YIPSGLIVIISWVSFWLNRNATP 250


>AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl
           subunit protein.
          Length = 365

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 7/23 (30%), Positives = 14/23 (60%)
 Frame = +2

Query: 518 FISEWIVDLVDWNQIYLLRNSTP 586
           +I   ++ ++ W   +L RN+TP
Sbjct: 167 YIPSGLIVIISWVSFWLNRNATP 189


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = -1

Query: 545 PNLLSIHL*ISNRYNYEISVH 483
           P LLS+HL  +  +  E+S H
Sbjct: 337 PPLLSVHLGGNAEFRCEVSTH 357


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = -1

Query: 545 PNLLSIHL*ISNRYNYEISVH 483
           P LLS+HL  +  +  E+S H
Sbjct: 337 PPLLSVHLGGNAEFRCEVSTH 357


>AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 10/33 (30%), Positives = 15/33 (45%)
 Frame = +2

Query: 125 ENTTWNRVKKIK*KNIAEYSLIHSYTK*EFTYN 223
           ++ TW  +KK    N+    L+      E TYN
Sbjct: 18  DSETWEAIKKDAAVNMEGQFLVRQIYDDEITYN 50


>AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 10/33 (30%), Positives = 15/33 (45%)
 Frame = +2

Query: 125 ENTTWNRVKKIK*KNIAEYSLIHSYTK*EFTYN 223
           ++ TW  +KK    N+    L+      E TYN
Sbjct: 18  DSETWEAIKKDAAVNMEGQFLVRQIYDDEITYN 50


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 181,157
Number of Sequences: 438
Number of extensions: 4134
Number of successful extensions: 20
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19193721
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).