SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0036
         (602 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    25   0.57 
AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase...    23   1.7  
DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450 monoo...    23   3.0  
EF032397-1|ABM97933.1|  200|Apis mellifera arginine kinase protein.    22   4.0  
AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precur...    22   4.0  
AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.    22   4.0  

>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
            protein.
          Length = 1308

 Score = 25.0 bits (52), Expect = 0.57
 Identities = 19/86 (22%), Positives = 43/86 (50%)
 Frame = -3

Query: 309  IVSRGRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKD 130
            + ++ ++ +  G    + ++ G  +    QQ  + +  +  +  L++V   L S + G+ 
Sbjct: 1070 VTNQQQSIQTSGMQRIIAQIGGKPIAVQIQQSPHQQQQQQQQKILAKV---LTSSNSGQ- 1125

Query: 129  LTSVQNLQKKHALLEADVSSHAERID 52
            L SV+NL  +  L  A  +SHA +++
Sbjct: 1126 LISVENLLAQKGLKLATTASHANQLN 1151


>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
           protein.
          Length = 1143

 Score = 23.4 bits (48), Expect = 1.7
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = -1

Query: 341 LELEHFAQPQISSRVEELGGI 279
           LEL+ FA P +S  V + GG+
Sbjct: 268 LELKWFAVPAVSGMVFDCGGL 288


>DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 548

 Score = 22.6 bits (46), Expect = 3.0
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = +2

Query: 452 STSRRWRTFSFLVYPTF 502
           ST ++WR    L+ PTF
Sbjct: 129 STGQKWRNHRKLIAPTF 145


>EF032397-1|ABM97933.1|  200|Apis mellifera arginine kinase protein.
          Length = 200

 Score = 22.2 bits (45), Expect = 4.0
 Identities = 14/50 (28%), Positives = 20/50 (40%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQK 103
           L+G        + QY    E +   LS +EG+L    Y     S +  QK
Sbjct: 114 LEGYPFNPCLTEAQYKEMEEKVSSTLSGLEGELKGTFYPLTGMSKETQQK 163


>AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precursor
           protein.
          Length = 405

 Score = 22.2 bits (45), Expect = 4.0
 Identities = 7/19 (36%), Positives = 11/19 (57%)
 Frame = +2

Query: 398 PVRSSDVSAPCHSGWSDPS 454
           P++    S  C+ GW +PS
Sbjct: 141 PIKRVKDSTNCNCGWKNPS 159


>AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.
          Length = 355

 Score = 22.2 bits (45), Expect = 4.0
 Identities = 14/50 (28%), Positives = 20/50 (40%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQK 103
           L+G        + QY    E +   LS +EG+L    Y     S +  QK
Sbjct: 130 LEGYPFNPCLTEAQYKEMEEKVSSTLSGLEGELKGTFYPLTGMSKETQQK 179


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 153,717
Number of Sequences: 438
Number of extensions: 2940
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17726685
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).