SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0035
         (392 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic ac...    26   0.18 
AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    24   0.72 
AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cycl...    21   6.7  
AB086196-1|BAD06465.1|  289|Apis mellifera Period protein.             21   6.7  
EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle pr...    20   8.8  
AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cycl...    20   8.8  
AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    20   8.8  
AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor ...    20   8.8  
AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cycl...    20   8.8  

>AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic
           acetylcholine Apisa7-2 subunit protein.
          Length = 461

 Score = 25.8 bits (54), Expect = 0.18
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = -2

Query: 289 VPY-RPSRPDGGASHDRGKHCARSIISCEAGLAHTGAIVYYQRGNF 155
           VPY R  RPD    ++     + ++I+    ++HTG +V+   G F
Sbjct: 82  VPYNRVWRPDTILYNNADPQYSSAVINTNVIVSHTGEVVWLSHGIF 127


>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 23.8 bits (49), Expect = 0.72
 Identities = 12/53 (22%), Positives = 26/53 (49%)
 Frame = -2

Query: 193 HTGAIVYYQRGNFFVAHLELVKLVRCRCDKMKIKRPAVTANREKQIPDCRPGA 35
           +T  I+Y    +F++  + +V L       ++ +     ANR+  + D +PG+
Sbjct: 340 NTDFIIYSSLSSFYIPCIIMVFLYYNIFKALRNRARKARANRKPNLGDIKPGS 392


>AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cyclase
           alpha 1 subunit protein.
          Length = 699

 Score = 20.6 bits (41), Expect = 6.7
 Identities = 8/17 (47%), Positives = 12/17 (70%)
 Frame = +2

Query: 59  LFLTVSSHCRAFNFHLV 109
           L + V+S C+AF +H V
Sbjct: 284 LRMGVASFCKAFPWHFV 300


>AB086196-1|BAD06465.1|  289|Apis mellifera Period protein.
          Length = 289

 Score = 20.6 bits (41), Expect = 6.7
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = -2

Query: 295 PSVPYRPSRPDGGASHDRGKHCARSIISCEAGLA 194
           P+      +P+   + D G+H   ++   EAGLA
Sbjct: 109 PTKSILEKKPELVDATDPGEHNGDTVTDVEAGLA 142


>EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle
           protein protein.
          Length = 138

 Score = 20.2 bits (40), Expect = 8.8
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -2

Query: 277 PSRPDGGASHD 245
           P RP GGA  D
Sbjct: 16  PQRPSGGADKD 26


>AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 20.2 bits (40), Expect = 8.8
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = +3

Query: 24  AGVPAPGRQSGICFSRLAV 80
           +G+P P R    C +RLA+
Sbjct: 473 SGLPEPCRCHARCIARLAL 491


>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
            protein.
          Length = 1308

 Score = 20.2 bits (40), Expect = 8.8
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -2

Query: 220  IISCEAGLAHTGAIVY 173
            +I   AGL  TGA VY
Sbjct: 1258 VIPTPAGLKTTGAAVY 1273


>AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor A
           isoform protein.
          Length = 567

 Score = 20.2 bits (40), Expect = 8.8
 Identities = 9/27 (33%), Positives = 13/27 (48%)
 Frame = -2

Query: 97  IKRPAVTANREKQIPDCRPGAGTPAPG 17
           +KR    A +EK  P+     G+P  G
Sbjct: 265 VKRKEEKAQKEKDKPNSTTMNGSPGSG 291


>AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 20.2 bits (40), Expect = 8.8
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = +3

Query: 24  AGVPAPGRQSGICFSRLAV 80
           +G+P P R    C +RLA+
Sbjct: 473 SGLPEPCRCHARCIARLAL 491


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 118,742
Number of Sequences: 438
Number of extensions: 2622
Number of successful extensions: 9
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used:  9638226
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).