SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0034
         (628 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein RJP...    28   0.086
AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex det...    24   1.1  
AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex det...    24   1.1  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    24   1.1  
AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex det...    24   1.1  
AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex det...    24   1.1  
AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex det...    24   1.1  
AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex det...    24   1.1  
AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex det...    24   1.1  
AF388659-3|AAK71993.1|  548|Apis mellifera 1D-myo-inositol-trisp...    23   1.8  
AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex det...    23   3.2  
AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex det...    23   3.2  
AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex det...    23   3.2  
AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex det...    23   3.2  
AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex det...    23   3.2  
AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex det...    23   3.2  
AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex det...    23   3.2  
AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex det...    23   3.2  
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    23   3.2  
AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex det...    23   3.2  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    23   3.2  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    23   3.2  
AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex det...    23   3.2  
AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex det...    23   3.2  
AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex det...    23   3.2  
AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex det...    23   3.2  

>Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein
           RJP57-1 protein.
          Length = 544

 Score = 27.9 bits (59), Expect = 0.086
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = -1

Query: 151 QNEFRETDHFNISNDWNTNDNFCHH 77
           +N  R+ D+ N  ND N NDN  HH
Sbjct: 515 RNGNRQNDNQNNQNDNNRNDNQVHH 539


>AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 10/44 (22%), Positives = 22/44 (50%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++VW ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQERER 51


>AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 10/44 (22%), Positives = 22/44 (50%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++VW ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQERER 51


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 10/44 (22%), Positives = 22/44 (50%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++VW ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQERER 51


>AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 10/44 (22%), Positives = 22/44 (50%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++VW ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQERER 51


>AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 10/44 (22%), Positives = 22/44 (50%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++VW ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQERER 51


>AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 10/44 (22%), Positives = 22/44 (50%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++VW ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQERER 51


>AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 10/44 (22%), Positives = 22/44 (50%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++VW ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQERER 51


>AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex
           determiner protein.
          Length = 413

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 10/44 (22%), Positives = 22/44 (50%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++VW ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDSKIDLRSRTKEERLQHRREVWLIQQERER 51


>AF388659-3|AAK71993.1|  548|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
          Length = 548

 Score = 23.4 bits (48), Expect = 1.8
 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 2/58 (3%)
 Frame = +1

Query: 193 KKMLRRQYSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDY--EKFRHGH 360
           K + +R+      +    + S   +DRR   S  +PSP        QD+  EK ++ H
Sbjct: 9   KSLSQRKIIRSRSRRYSKRFSSSIVDRRSPSSSRSPSPSLLTSQPHQDHNKEKSKNNH 66


>AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51


>AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51


>AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51


>AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51


>AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51


>AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51


>AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51


>AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51


>AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51


>AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51


>AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex
           determiner protein.
          Length = 385

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDNEIDLRSRTKEERLQHRREAWLIQQERER 51


>AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex
           determiner protein.
          Length = 425

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51


>AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex
           determiner protein.
          Length = 428

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/44 (20%), Positives = 21/44 (47%)
 Frame = +1

Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345
           YSH   K + +++ +  +D R           ++ W ++Q+ E+
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREAWLIQQERER 51


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 194,719
Number of Sequences: 438
Number of extensions: 4816
Number of successful extensions: 28
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 28
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18704709
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).