SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0031
         (558 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein p...    81   1e-17
AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein...    61   9e-12
DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.           56   2e-10
DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protei...    47   1e-07
DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly pro...    41   7e-06
AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly pro...    39   4e-05
Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein RJP...    38   7e-05
D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.         35   5e-04
AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly pro...    35   5e-04
AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly pro...    35   5e-04
U15954-1|AAA67442.1|   53|Apis mellifera abaecin precursor protein.    25   0.52 
AF442147-1|AAL35348.1|   33|Apis mellifera abaecin precursor pro...    25   0.69 
DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    22   3.7  
AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor typ...    22   3.7  
DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase ...    22   4.8  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    22   4.8  
AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cycl...    21   6.4  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              21   8.4  
AB264335-1|BAF44090.1|   87|Apis mellifera ecdysone-induced prot...    21   8.4  

>DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein
           protein.
          Length = 430

 Score = 80.6 bits (190), Expect = 1e-17
 Identities = 53/136 (38%), Positives = 71/136 (52%), Gaps = 3/136 (2%)
 Frame = +2

Query: 92  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR*VSQLL 271
           L E F W  +D+ YPD+ SK  A+  G  IPENALPVGIE WRNKLFV+VPRWR  + + 
Sbjct: 34  LLERFFWRTLDYAYPDEASKTMAMMKGEYIPENALPVGIEIWRNKLFVTVPRWR--NGIP 91

Query: 272 *TTFHWTLHMNHPRN*RPTRASKATN*AIVKQD*LLYTGSK--QTRCDRSLGIRRLAL-M 442
            T  + +L  N   + + T                + T  +     CDR   +    + +
Sbjct: 92  ATLTYISLDTNRGGSPKLTPYPNWAQNKAGACGSAITTAYRIHADSCDRLWVLDTGTIGI 151

Query: 443 DTTTLQMCAPYTLNVF 490
             TT+Q C PYTLN+F
Sbjct: 152 GNTTIQAC-PYTLNIF 166



 Score = 66.5 bits (155), Expect = 2e-13
 Identities = 39/91 (42%), Positives = 50/91 (54%), Gaps = 1/91 (1%)
 Frame = +1

Query: 202 WYRKVEEQIVRQRS*VALGIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTV 381
           W  K+   + R R+    GIPATL YI LD     SPKLTPYP++  N+ G C + +TT 
Sbjct: 75  WRNKLFVTVPRWRN----GIPATLTYISLDTNRGGSPKLTPYPNWAQNKAGACGSAITTA 130

Query: 382 YRVKADQV*SVFGY*TFGTYGYDNVT-NVCP 471
           YR+ AD    ++   T GT G  N T   CP
Sbjct: 131 YRIHADSCDRLWVLDT-GTIGIGNTTIQACP 160


>AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein
           protein.
          Length = 411

 Score = 60.9 bits (141), Expect = 9e-12
 Identities = 24/68 (35%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +2

Query: 53  FCGLVSLASAT-IKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKL 229
           F  +V LA A   +++ I+SWNV+++N+P+   +   +  G  I EN +P G++ W +K+
Sbjct: 4   FLWIVFLALANGEEIKTIYSWNVIEYNFPNDNIRNTLISNGDYIEENNMPNGMQIWNDKV 63

Query: 230 FVSVPRWR 253
           F+++PRW+
Sbjct: 64  FITIPRWK 71



 Score = 36.7 bits (81), Expect = 2e-04
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQV*SVFG 420
           G+P+ LN+  L      SPKL PYP++E N++    + +  + RV+ D    ++G
Sbjct: 73  GVPSNLNFF-LKNDESESPKLNPYPNWEMNDINKIDS-IINIIRVRVDACDRLWG 125


>DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.
          Length = 552

 Score = 56.4 bits (130), Expect = 2e-10
 Identities = 18/54 (33%), Positives = 38/54 (70%)
 Frame = +2

Query: 92  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           ++ +++W+ +D+ Y    ++  A+  G  I EN LP+G+E WR+K+F+++P+W+
Sbjct: 154 MELVYAWSTIDYTYDSIEARDSAIFDGDFITENNLPLGLEVWRDKVFITLPKWK 207



 Score = 50.4 bits (115), Expect = 1e-08
 Identities = 23/49 (46%), Positives = 35/49 (71%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQ 402
           GIP TL  +P  +  + SPKL PYP++E + +GNC  GLT+V+R++ D+
Sbjct: 209 GIPVTLTTVPKHSKTK-SPKLRPYPNWEWHTVGNCD-GLTSVFRIQVDE 255



 Score = 22.2 bits (45), Expect = 3.7
 Identities = 12/34 (35%), Positives = 16/34 (47%)
 Frame = +3

Query: 414 LWVLDVWHLWIRQRYKCVPRTRSMYFDLNTDQII 515
           LW+LD   + I +  K         FDL TD +I
Sbjct: 259 LWILDSGKVDIAKGGKLACPPAIFIFDLTTDTLI 292


>DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protein
           protein.
          Length = 424

 Score = 47.2 bits (107), Expect = 1e-07
 Identities = 20/71 (28%), Positives = 47/71 (66%), Gaps = 4/71 (5%)
 Frame = +2

Query: 47  LVFCGLVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERW--- 217
           ++F   +S + A  KL+ I+SW  +++ +P+ ++K  A+++G+ IP  +LP+ ++ +   
Sbjct: 9   ILFLLAISDSQAQEKLKNIYSWKALEFAFPNGYAKLAAIKSGSYIPGASLPIDVDVYNTE 68

Query: 218 -RNKLFVSVPR 247
            ++ +FV++PR
Sbjct: 69  QQSTVFVAIPR 79



 Score = 45.6 bits (103), Expect = 3e-07
 Identities = 18/49 (36%), Positives = 32/49 (65%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQ 402
           G+P TL Y+  +   + +P + PYP++  N++  C  GLT+VYR++ D+
Sbjct: 83  GVPLTLGYVTREVSIDGNPLIAPYPNWSYNDVKYCD-GLTSVYRMQVDK 130


>DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly
           protein 9 protein.
          Length = 423

 Score = 41.1 bits (92), Expect = 7e-06
 Identities = 14/48 (29%), Positives = 28/48 (58%)
 Frame = +2

Query: 104 FSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPR 247
           + W   D+N+     +Q A+++G    +N +P+ ++RW  K FV++ R
Sbjct: 36  YQWKYFDYNFGSDEKRQAAIQSGEYNYKNNVPIDVDRWNGKTFVTILR 83


>AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly
           protein MRJP5 protein.
          Length = 598

 Score = 38.7 bits (86), Expect = 4e-05
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +2

Query: 101 IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR*VSQLL 271
           I  W  +D+++     +Q A+++G        P  +++WR   FV+VPR++ V   L
Sbjct: 38  IHEWKYLDYDFGSDERRQAAMQSGEYDHTKNYPFDVDQWRGMTFVTVPRYKGVPSSL 94


>Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein
           RJP57-1 protein.
          Length = 544

 Score = 37.9 bits (84), Expect = 7e-05
 Identities = 13/52 (25%), Positives = 29/52 (55%)
 Frame = +2

Query: 92  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPR 247
           ++ I+ W  +D+++     +  A+++G        P  ++RWR+K FV++ R
Sbjct: 37  MKVIYEWKHIDFDFGSDERRDAAIKSGEFDHTKNYPFDVDRWRDKTFVTIER 88


>D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.
          Length = 432

 Score = 35.1 bits (77), Expect = 5e-04
 Identities = 15/57 (26%), Positives = 30/57 (52%)
 Frame = +2

Query: 101 IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR*VSQLL 271
           +  W   D+++     +Q A+ +G    +N  P  I++W +K+FV++ R+  V   L
Sbjct: 34  LHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSL 90


>AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 35.1 bits (77), Expect = 5e-04
 Identities = 15/57 (26%), Positives = 30/57 (52%)
 Frame = +2

Query: 101 IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR*VSQLL 271
           +  W   D+++     +Q A+ +G    +N  P  I++W +K+FV++ R+  V   L
Sbjct: 34  LHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSL 90


>AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 35.1 bits (77), Expect = 5e-04
 Identities = 15/57 (26%), Positives = 30/57 (52%)
 Frame = +2

Query: 101 IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR*VSQLL 271
           +  W   D+++     +Q A+ +G    +N  P  I++W +K+FV++ R+  V   L
Sbjct: 34  LHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSL 90


>U15954-1|AAA67442.1|   53|Apis mellifera abaecin precursor protein.
          Length = 53

 Score = 25.0 bits (52), Expect = 0.52
 Identities = 12/28 (42%), Positives = 15/28 (53%)
 Frame = +1

Query: 259 IPATLNYIPLDAPYEPSPKLTPYPSFEG 342
           I A   Y+PL  P  P P   P+P+F G
Sbjct: 14  ICAAFAYVPL--PNVPQPGRRPFPTFPG 39


>AF442147-1|AAL35348.1|   33|Apis mellifera abaecin precursor
           protein.
          Length = 33

 Score = 24.6 bits (51), Expect = 0.69
 Identities = 11/26 (42%), Positives = 14/26 (53%)
 Frame = +1

Query: 265 ATLNYIPLDAPYEPSPKLTPYPSFEG 342
           A   Y+PL  P  P P   P+P+F G
Sbjct: 2   AAFAYVPL--PNVPQPGRRPFPTFPG 25


>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = -2

Query: 233 RTICSSTFRYQRAVRSLVSEHQS 165
           R+I SS  RY R++     +HQ+
Sbjct: 379 RSIYSSLLRYPRSIFRQTDDHQN 401


>AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor type
           D2 protein.
          Length = 456

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 14/55 (25%), Positives = 22/55 (40%)
 Frame = +3

Query: 204 VSKGGGTNCSSAFLGGARYPSYFELHSTGRSI*TIPEINALPELRRQRIRQLSNR 368
           + +GGGTN  +  L      +  +L      + TI   N L  +   RI +   R
Sbjct: 260 IHRGGGTNTDARHLFRTASSTPEDLQDLEEPLTTIQHNNCLTRIPSTRINKQHTR 314


>DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase
           isoform B protein.
          Length = 931

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%)
 Frame = +2

Query: 140 QFSKQQALRTGALIPENALPV--GIERW 217
           Q SK +A+    LI  + LPV  G+ RW
Sbjct: 34  QDSKAKAIVVNTLISNDILPVCNGLWRW 61


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
           isoform A protein.
          Length = 969

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%)
 Frame = +2

Query: 140 QFSKQQALRTGALIPENALPV--GIERW 217
           Q SK +A+    LI  + LPV  G+ RW
Sbjct: 72  QDSKAKAIVVNTLISNDILPVCNGLWRW 99


>AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cyclase
           beta-3 protein.
          Length = 832

 Score = 21.4 bits (43), Expect = 6.4
 Identities = 9/20 (45%), Positives = 11/20 (55%)
 Frame = +1

Query: 433 GTYGYDNVTNVCPVHAQCIL 492
           G YGYD V +V   H +  L
Sbjct: 78  GQYGYDRVLSVLGRHVRDFL 97


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 8/15 (53%), Positives = 11/15 (73%)
 Frame = +1

Query: 436  TYGYDNVTNVCPVHA 480
            T+G+D VT+   VHA
Sbjct: 1351 TFGHDTVTHQLIVHA 1365


>AB264335-1|BAF44090.1|   87|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 87

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 8/14 (57%), Positives = 9/14 (64%)
 Frame = +3

Query: 195 CPLVSKGGGTNCSS 236
           C L +   GTNCSS
Sbjct: 7   CDLATPRTGTNCSS 20


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 164,120
Number of Sequences: 438
Number of extensions: 3725
Number of successful extensions: 25
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 16072521
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).