SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0028
         (633 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             28   0.087
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    27   0.15 
AB208107-1|BAE72139.1|   71|Apis mellifera Broad complex zinc fi...    26   0.26 
AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    25   0.61 
AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter...    25   0.81 
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       23   2.5  
DQ384991-1|ABD51779.1|   94|Apis mellifera allergen Api m 6 vari...    23   3.3  
DQ384990-1|ABD51778.1|   92|Apis mellifera allergen Api m 6 vari...    22   4.3  
DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    22   4.3  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    22   4.3  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    22   4.3  
DQ058012-1|AAY57281.1|  373|Apis mellifera venom allergen acid p...    22   5.7  
AY939855-1|AAX33235.1|  388|Apis mellifera venom acid phosphatas...    22   5.7  
AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly pro...    22   5.7  
AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly pro...    22   5.7  
DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex det...    21   9.9  
AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly pro...    21   9.9  

>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 27.9 bits (59), Expect = 0.087
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = -1

Query: 459  VLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ 280
            ++DH  S Q  QQ+Q + ++     +Q Q    +Q + P   QQ+ P   +QQ+ Q++ Q
Sbjct: 1492 IVDH--SSQKTQQQQPQQQQQ----QQQQQQPQQQSQQP---QQQQPQPQQQQQQQQQQQ 1542

Query: 279  L*EQQME 259
              +QQ E
Sbjct: 1543 PQQQQKE 1549



 Score = 23.4 bits (48), Expect = 1.9
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 2/57 (3%)
 Frame = -1

Query: 411 ECREPLAGLEQHQ--HSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRG 247
           + + P   L  HQ  H  A+    P   QQ+     +QQ+ Q++ Q  +QQ +  RG
Sbjct: 806 QSQPPHQQLHHHQSTHPQAQAQAQPQQQQQQ-----QQQQPQQQQQQQQQQQQQQRG 857



 Score = 23.0 bits (47), Expect = 2.5
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 1/59 (1%)
 Frame = -1

Query: 429 MQQEQGECREPLAGLEQHQHSMAKQ-HRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           ++QE  +    L     H  S A Q H  P   QQ+     +Q++ +RR++  E ++E+
Sbjct: 133 IKQETLQRHHHLQNHHHHLQSTAVQDHHRPYQQQQQQQQRQQQRQEERRLRPDEIKVEV 191



 Score = 21.0 bits (42), Expect = 9.9
 Identities = 12/47 (25%), Positives = 22/47 (46%)
 Frame = -1

Query: 420  EQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ 280
            EQ      + GL++ Q + A   +     QQ+     +QQ+ Q++ Q
Sbjct: 1187 EQYFATSRIRGLQEQQRNAAMVQQQQQQQQQQQQQQQQQQQQQQQQQ 1233



 Score = 21.0 bits (42), Expect = 9.9
 Identities = 12/43 (27%), Positives = 23/43 (53%)
 Frame = -1

Query: 366  MAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRGYGR 238
            + +Q R   + QQ+     +QQ+ Q++ Q  +QQ + H+   R
Sbjct: 1198 LQEQQRNAAMVQQQQQQQQQQQQQQQQQQQ-QQQQQQHQARER 1239


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 27.1 bits (57), Expect = 0.15
 Identities = 12/43 (27%), Positives = 22/43 (51%)
 Frame = -1

Query: 381 QHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
           Q QH   +Q    ++  Q+     +QQ+ Q++ Q  +QQ + H
Sbjct: 421 QQQHQQQQQQTQHVINAQQPQQQQQQQQQQQQQQQQQQQQQQH 463


>AB208107-1|BAE72139.1|   71|Apis mellifera Broad complex zinc
           finger domain-Z2 isoform protein.
          Length = 71

 Score = 26.2 bits (55), Expect = 0.26
 Identities = 11/29 (37%), Positives = 16/29 (55%)
 Frame = -1

Query: 564 STNKSFVLSLCRKALCSFSSIEQTLVQIH 478
           S  K F   LC K LCS +S+++ +   H
Sbjct: 1   SAKKLFTCQLCGKVLCSKASLKRHVADKH 29


>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 25.0 bits (52), Expect = 0.61
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
 Frame = -1

Query: 480 HTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQH-SMAKQHRMPLLGQQEVPHLLEQ 304
           H G+VL+  D     +     Q   + P    +Q QH S A+Q  +    Q    H++ Q
Sbjct: 150 HQGSVLDGPDSPPLVESQMHHQMHTQHPHMQPQQGQHQSQAQQQHL----QAHEQHMMYQ 205

Query: 303 QKVQRRVQL*EQQMELH 253
           Q+ Q +    + Q  +H
Sbjct: 206 QQQQSQAASQQSQPGMH 222


>AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter
           transporter-1A protein.
          Length = 203

 Score = 24.6 bits (51), Expect = 0.81
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = -2

Query: 338 WGSKRCRTYWSSKRC 294
           WGS  C  YW++K C
Sbjct: 98  WGS--CNNYWNTKNC 110


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 9/25 (36%), Positives = 17/25 (68%)
 Frame = +2

Query: 497 CSIDEKEHKAFLQRLKTKDLLVDKS 571
           C +  ++++AFL+ L T+  L D+S
Sbjct: 288 CEVICEDYQAFLKHLNTEHTLDDRS 312


>DQ384991-1|ABD51779.1|   94|Apis mellifera allergen Api m 6 variant
           2 precursor protein.
          Length = 94

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 13/41 (31%), Positives = 19/41 (46%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGIL 352
           P+++P PLC  IC    C  R  +  + +    C P S  L
Sbjct: 55  PNVVPKPLCIKICAP-GCVCRLGYLRNKK--KVCVPRSKCL 92


>DQ384990-1|ABD51778.1|   92|Apis mellifera allergen Api m 6 variant
           1 precursor protein.
          Length = 92

 Score = 22.2 bits (45), Expect = 4.3
 Identities = 12/38 (31%), Positives = 18/38 (47%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSS 343
           P+++P PLC  IC    C  R  +  + +    C P S
Sbjct: 55  PNVVPKPLCIKICAP-GCVCRLGYLRNKK--KVCVPRS 89


>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 22.2 bits (45), Expect = 4.3
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = +2

Query: 353 CCFAILCWCCSN 388
           CC    CWCC N
Sbjct: 11  CC----CWCCDN 18


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 22.2 bits (45), Expect = 4.3
 Identities = 6/14 (42%), Positives = 9/14 (64%)
 Frame = +2

Query: 353 CCFAILCWCCSNPA 394
           CC+  +CW  + PA
Sbjct: 488 CCWWKICWTITTPA 501


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 22.2 bits (45), Expect = 4.3
 Identities = 6/14 (42%), Positives = 9/14 (64%)
 Frame = +2

Query: 353 CCFAILCWCCSNPA 394
           CC+  +CW  + PA
Sbjct: 541 CCWWKICWTITTPA 554


>DQ058012-1|AAY57281.1|  373|Apis mellifera venom allergen acid
           phosphatase protein.
          Length = 373

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 9/25 (36%), Positives = 14/25 (56%)
 Frame = -2

Query: 539 VFVERPCVLFHLSNKRWCKSIRGTY 465
           +F+   C+LF +   R  +S RG Y
Sbjct: 124 IFLPEDCLLFTIELDRVLESPRGKY 148


>AY939855-1|AAX33235.1|  388|Apis mellifera venom acid phosphatase
           precursor protein.
          Length = 388

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 9/25 (36%), Positives = 14/25 (56%)
 Frame = -2

Query: 539 VFVERPCVLFHLSNKRWCKSIRGTY 465
           +F+   C+LF +   R  +S RG Y
Sbjct: 139 IFLPEDCLLFTIELDRVLESPRGKY 163


>AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly
           protein MRJP6 protein.
          Length = 437

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 1/25 (4%)
 Frame = -1

Query: 102 YCW-NSCDCTRFSSNYKGSSDEYDR 31
           + W N  DC+   S YK + D++DR
Sbjct: 114 WSWANYKDCSGIVSAYKIAIDKFDR 138


>AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly
           protein MRJP5 protein.
          Length = 598

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 1/25 (4%)
 Frame = -1

Query: 102 YCW-NSCDCTRFSSNYKGSSDEYDR 31
           + W N  DC+   S YK + D++DR
Sbjct: 114 WSWANYKDCSGIVSAYKIAIDKFDR 138


>DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = +1

Query: 130 HVGYAQAIPQNIPPYA 177
           H+G +   PQ IPP A
Sbjct: 152 HIGPSTPFPQFIPPNA 167


>AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly
           protein MRJP2 protein.
          Length = 452

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 7/18 (38%), Positives = 13/18 (72%)
 Frame = -1

Query: 84  DCTRFSSNYKGSSDEYDR 31
           DC++  S +K + D++DR
Sbjct: 118 DCSKIVSAFKIAIDKFDR 135


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 141,538
Number of Sequences: 438
Number of extensions: 3154
Number of successful extensions: 31
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18949215
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).