SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0027
         (611 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF080430-1|AAC28863.2|  208|Apis mellifera ribosomal protein S8 ...    25   0.58 
DQ855483-1|ABH88170.1|  117|Apis mellifera chemosensory protein ...    21   7.2  
DQ201783-1|ABB05503.1|  381|Apis mellifera capa receptor-like GP...    21   7.2  
AJ973398-1|CAJ01445.1|  117|Apis mellifera hypothetical protein ...    21   7.2  

>AF080430-1|AAC28863.2|  208|Apis mellifera ribosomal protein S8
           protein.
          Length = 208

 Score = 25.0 bits (52), Expect = 0.58
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = +3

Query: 30  TIKTRL*QKSYMKTLNM*VRTRTQRRNCLVNKDILYFR 143
           T KTR+    Y  + N  VRT+T  +N +V  D   FR
Sbjct: 73  TRKTRIIDVVYNASNNELVRTKTLVKNAIVTIDATPFR 110


>DQ855483-1|ABH88170.1|  117|Apis mellifera chemosensory protein 2
           protein.
          Length = 117

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 10/26 (38%), Positives = 12/26 (46%)
 Frame = +2

Query: 305 ALQHIPLSPAGVIAKRPAPIALPNSC 382
           AL   P  P G   K  AP+ L  +C
Sbjct: 55  ALGEAPCDPVGRRLKSLAPLVLRGAC 80


>DQ201783-1|ABB05503.1|  381|Apis mellifera capa receptor-like GPCR
           protein.
          Length = 381

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -1

Query: 581 ESTFFNSGLLFQTGTTLNPI 522
           E  +  SG L+   TT+NPI
Sbjct: 307 EWLYILSGCLYYFSTTINPI 326


>AJ973398-1|CAJ01445.1|  117|Apis mellifera hypothetical protein
           protein.
          Length = 117

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 10/26 (38%), Positives = 12/26 (46%)
 Frame = +2

Query: 305 ALQHIPLSPAGVIAKRPAPIALPNSC 382
           AL   P  P G   K  AP+ L  +C
Sbjct: 55  ALGEAPCDPVGRRLKSLAPLVLRGAC 80


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 180,143
Number of Sequences: 438
Number of extensions: 3810
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18093444
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).