SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0026
         (630 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     25   0.80 
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    23   2.4  
U15956-1|AAA67444.1|  129|Apis mellifera hymenoptaecin precursor...    22   4.3  
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    22   4.3  
DQ435324-1|ABD92639.1|  152|Apis mellifera OBP3 protein.               21   7.5  
AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C prot...    21   7.5  
AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    21   9.9  
AB086196-1|BAD06465.1|  289|Apis mellifera Period protein.             21   9.9  

>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 24.6 bits (51), Expect = 0.80
 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 4/56 (7%)
 Frame = +3

Query: 459 PAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKG----YALPPRHSLRFGT 614
           P  Y   Q V++      PPV   TSA V S   P  +     Y +P    L F T
Sbjct: 165 PLTYHQFQTVVASMDPPEPPVPTVTSACVGSAYTPLKEDHDDHYGVPTLEELGFDT 220


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 10/26 (38%), Positives = 15/26 (57%)
 Frame = +3

Query: 351  LRVAPEEHPVLLTEAPLNPKANREKM 428
            LR+ P  H V+ T   +NP  + EK+
Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486


>U15956-1|AAA67444.1|  129|Apis mellifera hymenoptaecin precursor
           protein.
          Length = 129

 Score = 22.2 bits (45), Expect = 4.3
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = -2

Query: 512 YAGRVQREHGLDGDVHGG 459
           Y  RV  ++G+ GD +GG
Sbjct: 60  YKQRVYDKNGMTGDAYGG 77


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 22.2 bits (45), Expect = 4.3
 Identities = 11/34 (32%), Positives = 15/34 (44%), Gaps = 3/34 (8%)
 Frame = +3

Query: 513 PPVSCWTSATVSSTPCPFTKGYALPP---RHSLR 605
           PP+ C      S T C F +   L P   +H +R
Sbjct: 431 PPIGCECKTCNSKTKCCFAQDDGLCPYTLKHKIR 464


>DQ435324-1|ABD92639.1|  152|Apis mellifera OBP3 protein.
          Length = 152

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 258 LFALCLISYIRV 223
           LF LC++SY+ V
Sbjct: 8   LFTLCIVSYMMV 19


>AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C
           protein.
          Length = 149

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +1

Query: 115 GMCKAGFAGD 144
           GMCK G +GD
Sbjct: 130 GMCKEGISGD 139


>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 8/18 (44%), Positives = 10/18 (55%)
 Frame = -1

Query: 174 DRGEHGARSIISCETGLA 121
           D GEH   ++   E GLA
Sbjct: 130 DPGEHNGDTVTDVEAGLA 147


>AB086196-1|BAD06465.1|  289|Apis mellifera Period protein.
          Length = 289

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 8/18 (44%), Positives = 10/18 (55%)
 Frame = -1

Query: 174 DRGEHGARSIISCETGLA 121
           D GEH   ++   E GLA
Sbjct: 125 DPGEHNGDTVTDVEAGLA 142


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 203,943
Number of Sequences: 438
Number of extensions: 4998
Number of successful extensions: 10
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18826962
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).