SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0025
         (588 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          24   0.96 
DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    23   2.9  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    23   2.9  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    22   5.1  
DQ435326-1|ABD92641.1|  132|Apis mellifera OBP9 protein.               21   6.8  
DQ435329-1|ABD92644.1|  150|Apis mellifera OBP12 protein.              21   9.0  
DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.       21   9.0  
AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    21   9.0  
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    21   9.0  
AB083010-1|BAC54131.1|  132|Apis mellifera fatty acid binding pr...    21   9.0  

>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 24.2 bits (50), Expect = 0.96
 Identities = 14/61 (22%), Positives = 27/61 (44%)
 Frame = +2

Query: 197 EEKLQKTIGSGVLPKVRLQKNNAEFRRYKCNTSCISGSFYSKRVHDGLQPAFNNGRGHSV 376
           EE  + T G+ VL   +   NN+       NT+  + +  +   ++    A +NG G+  
Sbjct: 204 EECTEATAGAVVLETCQRNSNNSTITAGNANTNASNNNNNNNNNNNNNNGANDNGNGNGA 263

Query: 377 T 379
           +
Sbjct: 264 S 264


>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 7/15 (46%), Positives = 12/15 (80%)
 Frame = +1

Query: 112 LFAFILMSFTVCTTI 156
           +FA IL+S ++C T+
Sbjct: 312 IFAMILVSISICVTV 326


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 7/15 (46%), Positives = 12/15 (80%)
 Frame = +1

Query: 112 LFAFILMSFTVCTTI 156
           +FA IL+S ++C T+
Sbjct: 312 IFAMILVSISICVTV 326


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 6/20 (30%), Positives = 13/20 (65%)
 Frame = -1

Query: 540 ILLKCLLPQQNNNFLCIGRH 481
           ++++ L P  N N+ C+ R+
Sbjct: 670 LMIEHLSPDHNGNYSCVARN 689


>DQ435326-1|ABD92641.1|  132|Apis mellifera OBP9 protein.
          Length = 132

 Score = 21.4 bits (43), Expect = 6.8
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 180 FEEADEKKNCRR 215
           F EAD KK+CR+
Sbjct: 20  FGEADIKKDCRK 31


>DQ435329-1|ABD92644.1|  150|Apis mellifera OBP12 protein.
          Length = 150

 Score = 21.0 bits (42), Expect = 9.0
 Identities = 7/21 (33%), Positives = 11/21 (52%)
 Frame = +2

Query: 239 KVRLQKNNAEFRRYKCNTSCI 301
           +++L      FR Y C  +CI
Sbjct: 55  RIKLINEEENFRNYGCFLACI 75


>DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.
          Length = 630

 Score = 21.0 bits (42), Expect = 9.0
 Identities = 8/21 (38%), Positives = 13/21 (61%)
 Frame = +1

Query: 103 NNYLFAFILMSFTVCTTIEQS 165
           NNYLF  + +    C+ +EQ+
Sbjct: 405 NNYLFLAVGIVGGACSDVEQN 425


>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 21.0 bits (42), Expect = 9.0
 Identities = 8/21 (38%), Positives = 13/21 (61%)
 Frame = +3

Query: 321 SASTMVSSQPLIMAEGTASPN 383
           +AST V  +P++    + SPN
Sbjct: 494 AASTAVIHEPVVETNSSPSPN 514


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 21.0 bits (42), Expect = 9.0
 Identities = 8/35 (22%), Positives = 16/35 (45%)
 Frame = -1

Query: 540 ILLKCLLPQQNNNFLCIGRHCTVGYSVGNLALPKF 436
           + L C+   Q N+ +C+        S+ N +  +F
Sbjct: 281 VRLACMFDAQTNSMICLNGQVLKRESIHNSSNARF 315


>AB083010-1|BAC54131.1|  132|Apis mellifera fatty acid binding
           protein protein.
          Length = 132

 Score = 21.0 bits (42), Expect = 9.0
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = +2

Query: 206 LQKTIGSGVLPKVRLQKNN 262
           + + +GS V P V L +NN
Sbjct: 29  MTRKVGSSVSPVVELTENN 47


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 165,295
Number of Sequences: 438
Number of extensions: 3794
Number of successful extensions: 13
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17115420
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).