SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0021
         (393 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY739659-1|AAU85298.1|  288|Apis mellifera hyperpolarization-act...    21   5.1  
AY739658-1|AAU85297.1|  664|Apis mellifera hyperpolarization-act...    21   5.1  
AY280848-1|AAQ16312.1|  632|Apis mellifera hyperpolarization-act...    21   5.1  
AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly pro...    21   5.1  

>AY739659-1|AAU85298.1|  288|Apis mellifera
           hyperpolarization-activated ion channelvariant T
           protein.
          Length = 288

 Score = 21.0 bits (42), Expect = 5.1
 Identities = 12/45 (26%), Positives = 20/45 (44%)
 Frame = -3

Query: 319 TVFLSTIL*TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSI 185
           T+FL  I+        ++ NA   +     + K + + WF LD I
Sbjct: 130 TIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLI 174


>AY739658-1|AAU85297.1|  664|Apis mellifera
           hyperpolarization-activated ion channelvariant L
           protein.
          Length = 664

 Score = 21.0 bits (42), Expect = 5.1
 Identities = 12/45 (26%), Positives = 20/45 (44%)
 Frame = -3

Query: 319 TVFLSTIL*TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSI 185
           T+FL  I+        ++ NA   +     + K + + WF LD I
Sbjct: 130 TIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLI 174


>AY280848-1|AAQ16312.1|  632|Apis mellifera
           hyperpolarization-activated ion channel protein.
          Length = 632

 Score = 21.0 bits (42), Expect = 5.1
 Identities = 12/45 (26%), Positives = 20/45 (44%)
 Frame = -3

Query: 319 TVFLSTIL*TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSI 185
           T+FL  I+        ++ NA   +     + K + + WF LD I
Sbjct: 130 TIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLI 174


>AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly
           protein MRJP2 protein.
          Length = 452

 Score = 21.0 bits (42), Expect = 5.1
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -2

Query: 188 DKTSATILRCDG 153
           DKT  TILR DG
Sbjct: 75  DKTFVTILRYDG 86


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 85,971
Number of Sequences: 438
Number of extensions: 1512
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used:  9638226
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).