SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0017
         (477 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY273778-1|AAP33487.1|  427|Apis mellifera ultraspiracle protein...    23   1.7  
AF263459-1|AAF73057.1|  427|Apis mellifera ultraspiracle protein...    23   1.7  
AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly pro...    23   2.2  
AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.          22   2.9  
AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly pro...    22   2.9  
DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase ...    22   3.9  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    22   3.9  
AB264335-1|BAF44090.1|   87|Apis mellifera ecdysone-induced prot...    21   5.1  
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    21   5.1  
AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phospha...    21   6.8  

>AY273778-1|AAP33487.1|  427|Apis mellifera ultraspiracle protein
           protein.
          Length = 427

 Score = 23.0 bits (47), Expect = 1.7
 Identities = 12/33 (36%), Positives = 14/33 (42%)
 Frame = +2

Query: 218 CYRVKI*IVSANTECRCQVCRVK*TLKYGRFRE 316
           C   K  I+      RCQ CR +  L  G  RE
Sbjct: 146 CREEKSCIIDKRQRNRCQYCRYQKCLAMGMKRE 178


>AF263459-1|AAF73057.1|  427|Apis mellifera ultraspiracle protein
           protein.
          Length = 427

 Score = 23.0 bits (47), Expect = 1.7
 Identities = 12/33 (36%), Positives = 14/33 (42%)
 Frame = +2

Query: 218 CYRVKI*IVSANTECRCQVCRVK*TLKYGRFRE 316
           C   K  I+      RCQ CR +  L  G  RE
Sbjct: 146 CREEKSCIIDKRQRNRCQYCRYQKCLAMGMKRE 178


>AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly
           protein MRJP5 protein.
          Length = 598

 Score = 22.6 bits (46), Expect = 2.2
 Identities = 9/31 (29%), Positives = 14/31 (45%)
 Frame = +2

Query: 251 NTECRCQVCRVK*TLKYGRFREKTIGCYSRH 343
           NTE   ++      L +G      IGC++ H
Sbjct: 304 NTESIAKIMSKNGVLFFGLMNNSAIGCWNEH 334


>AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.2 bits (45), Expect = 2.9
 Identities = 15/44 (34%), Positives = 21/44 (47%)
 Frame = -3

Query: 364 DQKTISKMAAVAANCLLSESAIFQRSLDPTNLTPTLSVRTHNSY 233
           + KT  K A +++N L S S  FQR+    +    L     NSY
Sbjct: 203 ETKTCKKYA-ISSNSLRSRSRSFQRTSSCHSRYEDLRHEDRNSY 245


>AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly
           protein MRJP6 protein.
          Length = 437

 Score = 22.2 bits (45), Expect = 2.9
 Identities = 9/31 (29%), Positives = 14/31 (45%)
 Frame = +2

Query: 251 NTECRCQVCRVK*TLKYGRFREKTIGCYSRH 343
           NT+   +V      L +G      IGC++ H
Sbjct: 304 NTQSSAKVMSKNGVLFFGLVNNSAIGCWNEH 334


>DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase
           isoform B protein.
          Length = 931

 Score = 21.8 bits (44), Expect = 3.9
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%)
 Frame = +3

Query: 129 SCYSFSLQLTQVFQSSSFSY-NTKCLD 206
           S YSF  +L  +F SSS  + +T  LD
Sbjct: 477 SIYSFLERLNLIFMSSSLQWSSTHTLD 503


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
           isoform A protein.
          Length = 969

 Score = 21.8 bits (44), Expect = 3.9
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%)
 Frame = +3

Query: 129 SCYSFSLQLTQVFQSSSFSY-NTKCLD 206
           S YSF  +L  +F SSS  + +T  LD
Sbjct: 515 SIYSFLERLNLIFMSSSLQWSSTHTLD 541


>AB264335-1|BAF44090.1|   87|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 87

 Score = 21.4 bits (43), Expect = 5.1
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 263 RCQVCRVK*TLKYGRFRE 316
           RCQ CR+K  +  G  R+
Sbjct: 70  RCQYCRLKKCIAVGMSRD 87


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 21.4 bits (43), Expect = 5.1
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 263 RCQVCRVK*TLKYGRFRE 316
           RCQ CR+K  +  G  R+
Sbjct: 119 RCQYCRLKKCIAVGMSRD 136


>AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phosphate
           dehydrogenase protein.
          Length = 363

 Score = 21.0 bits (42), Expect = 6.8
 Identities = 10/27 (37%), Positives = 17/27 (62%)
 Frame = +3

Query: 378 VEAHRNSTKMSYVCPPSFIRLGHSCLF 458
           VEA +++  +++V P  FI+   S LF
Sbjct: 81  VEAAKDADILTFVVPHQFIKRICSALF 107


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 124,320
Number of Sequences: 438
Number of extensions: 2290
Number of successful extensions: 10
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12928545
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).