SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0015
         (657 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    22   4.5  
AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase...    22   4.5  
DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    21   7.8  
DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chlor...    21   7.8  
AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precur...    21   7.8  

>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 10/24 (41%), Positives = 14/24 (58%)
 Frame = -1

Query: 87  MVSFFKRKF*FYLFDRY*CKCVIV 16
           +V   KR+  +YLF  Y   C+IV
Sbjct: 236 VVFVLKRRLGYYLFHTYIPTCLIV 259


>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
           protein.
          Length = 1143

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = -2

Query: 461 NSYFWRMKAVFLRAVKHIILRWSFSYIKTN**REIS 354
           N Y  +M   ++ +   I L  S S+IK N   E+S
Sbjct: 539 NLYAMKMNETYINSGNKISLATSKSFIKANSQTEVS 574


>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = -1

Query: 75  FKRKF*FYLFDRY*CKCVIV 16
           FKR+F +YL   Y   C++V
Sbjct: 237 FKREFSYYLIQIYIPCCMLV 256


>DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = -1

Query: 75  FKRKF*FYLFDRY*CKCVIV 16
           FKR+F +YL   Y   C++V
Sbjct: 237 FKREFSYYLIQIYIPCCMLV 256


>AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precursor
           protein.
          Length = 405

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +2

Query: 437 LSFSRNKNCN 466
           + FS NKNCN
Sbjct: 87  VEFSENKNCN 96


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 186,110
Number of Sequences: 438
Number of extensions: 3702
Number of successful extensions: 6
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19734030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).