SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0014
         (593 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor pro...    24   0.98 
AB238796-1|BAE93398.1|  128|Apis mellifera Queen brain-selective...    23   3.0  
DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex det...    21   6.9  
DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex det...    21   6.9  
DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex det...    21   6.9  
DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex det...    21   6.9  
DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex det...    21   6.9  
DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex det...    21   6.9  
DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex det...    21   6.9  
DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex det...    21   6.9  
DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex det...    21   6.9  
DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex det...    21   6.9  
DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex det...    21   6.9  
DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex det...    21   6.9  
DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex det...    21   9.1  
DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex det...    21   9.1  
DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex det...    21   9.1  
AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex det...    21   9.1  
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    21   9.1  
AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex det...    21   9.1  

>DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor
           protein.
          Length = 405

 Score = 24.2 bits (50), Expect = 0.98
 Identities = 9/25 (36%), Positives = 15/25 (60%)
 Frame = +3

Query: 402 RNLSLYECQGLVPERNLIVRRLPSV 476
           RNL   E + + P RN+++ R  S+
Sbjct: 230 RNLEATESENVRPRRNVLIERAKSI 254


>AB238796-1|BAE93398.1|  128|Apis mellifera Queen brain-selective
           protein-1 protein.
          Length = 128

 Score = 22.6 bits (46), Expect = 3.0
 Identities = 8/20 (40%), Positives = 11/20 (55%)
 Frame = -2

Query: 592 QCSKCSRERCGVAHGVIGLC 533
           QC+K   E CG     +G+C
Sbjct: 60  QCAKGPDELCGGPQNYLGIC 79


>DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 10/31 (32%), Positives = 12/31 (38%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW + Q       H
Sbjct: 124 PVPVPIYCGNFPPRPLGPWISIQEQIPRFRH 154


>DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 10/31 (32%), Positives = 12/31 (38%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW + Q       H
Sbjct: 124 PVPVPIYCGNFPPRPLGPWISIQEQIPRFRH 154


>DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 10/31 (32%), Positives = 12/31 (38%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW + Q       H
Sbjct: 124 PVPVPIYCGNFPPRPLGPWISIQEQIPRFRH 154


>DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 10/31 (32%), Positives = 12/31 (38%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW + Q       H
Sbjct: 124 PVPVPIYCGNFPPRPLGPWISIQEQIPRFRH 154


>DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 10/31 (32%), Positives = 11/31 (35%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW   Q       H
Sbjct: 122 PVPVPIYCGNFPSRPMGPWVPMQEQIPRFRH 152


>DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 10/31 (32%), Positives = 11/31 (35%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW   Q       H
Sbjct: 122 PVPVPIYCGNFPSRPMGPWVPMQEQIPRFRH 152


>DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 10/31 (32%), Positives = 11/31 (35%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW   Q       H
Sbjct: 122 PVPVPIYCGNFPSRPMGPWVPMQEQIPRFRH 152


>DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 10/31 (32%), Positives = 11/31 (35%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW   Q       H
Sbjct: 122 PVPVPIYCGNFPSRPMGPWVPMQEQIPRFRH 152


>DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 10/31 (32%), Positives = 11/31 (35%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW   Q       H
Sbjct: 122 PVPVPIYCGNFPSRPMGPWVPMQEQIPRFRH 152


>DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 10/31 (32%), Positives = 11/31 (35%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW   Q       H
Sbjct: 122 PVPVPIYCGNFPSRPMGPWVPMQEQIPRFRH 152


>DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 10/31 (32%), Positives = 11/31 (35%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW   Q       H
Sbjct: 122 PVPVPIYCGNFPSRPMGPWVPMQEQIPRFRH 152


>DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex
           determiner protein.
          Length = 186

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 10/31 (32%), Positives = 11/31 (35%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW   Q       H
Sbjct: 125 PVPVPIYCGNFPSRPMGPWVPMQEQIPRFRH 155


>DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 21.0 bits (42), Expect = 9.1
 Identities = 10/31 (32%), Positives = 12/31 (38%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW + Q       H
Sbjct: 121 PVPVPVYCGNFPPRPMGPWISIQEQIPRFRH 151


>DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 21.0 bits (42), Expect = 9.1
 Identities = 10/31 (32%), Positives = 12/31 (38%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW + Q       H
Sbjct: 122 PVPVPIYCGNFPPRPMGPWISIQEQIPRFRH 152


>DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex
           determiner protein.
          Length = 178

 Score = 21.0 bits (42), Expect = 9.1
 Identities = 10/31 (32%), Positives = 12/31 (38%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW + Q       H
Sbjct: 117 PVPVPIYCGNFPPRPMGPWISIQEQIPRFRH 147


>AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 21.0 bits (42), Expect = 9.1
 Identities = 10/31 (32%), Positives = 12/31 (38%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW + Q       H
Sbjct: 345 PVPVPIYCGNFPPRPMGPWISIQEQIPRFRH 375


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 21.0 bits (42), Expect = 9.1
 Identities = 10/31 (32%), Positives = 12/31 (38%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW + Q       H
Sbjct: 358 PVPVPIYCGNFPPRPMGPWISIQEQIPRFRH 388


>AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.0 bits (42), Expect = 9.1
 Identities = 10/31 (32%), Positives = 12/31 (38%)
 Frame = +3

Query: 498 PVHEPDVCYKTIHRPITPWATPQRSREHLLH 590
           PV  P  C     RP+ PW + Q       H
Sbjct: 347 PVPVPVYCGNFPPRPMGPWISIQEQIPRFRH 377


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 164,110
Number of Sequences: 438
Number of extensions: 3273
Number of successful extensions: 25
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 25
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17359926
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).