SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0013
         (573 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor typ...    26   0.30 
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    24   0.93 
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    24   0.93 
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              23   2.1  
AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    22   5.0  
AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex det...    22   5.0  
AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex det...    22   5.0  
AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex det...    22   5.0  
AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex det...    22   5.0  
AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex det...    22   5.0  
AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex det...    22   5.0  
AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex det...    22   5.0  
AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex det...    22   5.0  
AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex det...    22   5.0  
AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex det...    22   5.0  
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    22   5.0  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    22   5.0  
AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex det...    22   5.0  
AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex det...    22   5.0  
AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex det...    22   5.0  
AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    22   5.0  
AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex det...    21   6.6  
AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex det...    21   6.6  
AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex det...    21   6.6  
AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex det...    21   8.7  

>AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor type
           D2 protein.
          Length = 456

 Score = 25.8 bits (54), Expect = 0.30
 Identities = 13/39 (33%), Positives = 20/39 (51%)
 Frame = +1

Query: 37  FMNL*TTRFPTAGHLSQCTPMILVAPFSLCRERGETRWL 153
           +++  T  F T+   + C   ++V PFS   E  E RWL
Sbjct: 75  YLHTATNYFVTSLAFADCLVGLVVMPFSAIYEVLENRWL 113


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 24.2 bits (50), Expect = 0.93
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = -3

Query: 202 GHAVGDIPGVRFKVVKVANVSLL 134
           GH V D+PGVR +V++   + LL
Sbjct: 69  GHPVNDVPGVR-RVLRNGTLVLL 90


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 24.2 bits (50), Expect = 0.93
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = -3

Query: 202 GHAVGDIPGVRFKVVKVANVSLL 134
           GH V D+PGVR +V++   + LL
Sbjct: 69  GHPVNDVPGVR-RVLRNGTLVLL 90


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 23.0 bits (47), Expect = 2.1
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = -3

Query: 202 GHAVGDIPGVR 170
           G AVGD+PG+R
Sbjct: 42  GSAVGDVPGLR 52


>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/25 (36%), Positives = 14/25 (56%)
 Frame = -2

Query: 449 SHDVVKRRPVNCNTTHYRANWVPGP 375
           S +  K++P +C+T  YR   V  P
Sbjct: 560 SDECNKKQPSDCDTLEYRNGEVTTP 584


>AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGH 197
           N IEE+D VLV    + G+
Sbjct: 176 NKIEEHDTVLVVNIKKSGN 194


>AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGH 197
           N IEE+D VLV    + G+
Sbjct: 187 NKIEEHDTVLVVNIKKSGN 205


>AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGH 197
           N IEE+D VLV    + G+
Sbjct: 176 NKIEEHDTVLVVNIKKSGN 194


>AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGH 197
           N IEE+D VLV    + G+
Sbjct: 187 NKIEEHDTVLVVNIKKSGN 205


>AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGH 197
           N IEE+D VLV    + G+
Sbjct: 187 NKIEEHDTVLVVNIKKSGN 205


>AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGH 197
           N IEE+D VLV    + G+
Sbjct: 187 NKIEEHDTVLVVNIKKSGN 205


>AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGH 197
           N IEE+D VLV    + G+
Sbjct: 187 NKIEEHDTVLVVNIKKSGN 205


>AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGH 197
           N IEE+D VLV    + G+
Sbjct: 187 NKIEEHDTVLVVNIKKSGN 205


>AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGH 197
           N IEE+D VLV    + G+
Sbjct: 187 NKIEEHDTVLVVNIKKSGN 205


>AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGH 197
           N IEE+D VLV    + G+
Sbjct: 176 NKIEEHDTVLVVNIKKSGN 194


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGH 197
           N IEE+D VLV    + G+
Sbjct: 187 NKIEEHDTVLVVNIKKSGN 205


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGH 197
           N IEE+D VLV    + G+
Sbjct: 187 NKIEEHDTVLVVNIKKSGN 205


>AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGH 197
           N IEE+D VLV    + G+
Sbjct: 187 NKIEEHDTVLVVNIKKSGN 205


>AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex
           determiner protein.
          Length = 385

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGH 197
           N IEE+D VLV    + G+
Sbjct: 187 NKIEEHDTVLVVNIEKSGN 205


>AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex
           determiner protein.
          Length = 425

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGH 197
           N IEE+D VLV    + G+
Sbjct: 187 NKIEEHDTVLVVNIKKSGN 205


>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = -1

Query: 342 PNSAIRKCV 316
           PNSA+RKC+
Sbjct: 584 PNSAVRKCM 592


>AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.4 bits (43), Expect = 6.6
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKG 200
           N IEE+D VLV    + G
Sbjct: 176 NKIEEHDTVLVVNIEKSG 193


>AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.4 bits (43), Expect = 6.6
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKG 200
           N IEE+D VLV    + G
Sbjct: 187 NKIEEHDTVLVVNIEKSG 204


>AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.4 bits (43), Expect = 6.6
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKG 200
           N IEE+D VLV    + G
Sbjct: 176 NKIEEHDTVLVVNIEKSG 193


>AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 9/18 (50%), Positives = 10/18 (55%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKG 200
           N IEE D VLV    + G
Sbjct: 187 NKIEEQDTVLVVNIEKSG 204


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,662
Number of Sequences: 438
Number of extensions: 3926
Number of successful extensions: 28
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 27
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 16504155
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).