SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0008
         (564 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex det...    25   0.53 
DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channe...    23   1.6  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    22   3.7  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    22   3.7  
DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex det...    22   4.9  
DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex det...    21   6.5  
U70841-1|AAC47455.1|  377|Apis mellifera ultraviolet sensitive o...    21   8.6  
DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex det...    21   8.6  
DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex det...    21   8.6  
DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex det...    21   8.6  
DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex det...    21   8.6  
DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex det...    21   8.6  
DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex det...    21   8.6  
DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex det...    21   8.6  
DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex det...    21   8.6  
DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex det...    21   8.6  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    21   8.6  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    21   8.6  
AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter...    21   8.6  
AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex det...    21   8.6  
AF004168-1|AAC13417.1|  377|Apis mellifera blue-sensitive opsin ...    21   8.6  

>AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex
           determiner protein.
          Length = 425

 Score = 25.0 bits (52), Expect = 0.53
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +1

Query: 283 FTLYMNYNNSYGYINCYN 336
           ++ Y NYNN+Y   N YN
Sbjct: 324 YSNYNNYNNNYNNYNNYN 341


>DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channel
           protein.
          Length = 489

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 8/27 (29%), Positives = 15/27 (55%)
 Frame = -1

Query: 96  KTCIFYFVSCFIYIFSVV*FTSVCNYS 16
           K    Y V CF+++F+ +   +  NY+
Sbjct: 302 KAIDIYLVMCFVFVFAALLEYAAVNYT 328


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 9/38 (23%), Positives = 20/38 (52%)
 Frame = +2

Query: 137  IKYKWNGLNVGNRLKRSLEMSISHYQSTENR*ARRSGT 250
            +  +W    +G+R++R ++ S  + Q+ E +  R   T
Sbjct: 1631 VALRWRSRYLGDRMQRPMKESQENQQNAETQRERYYAT 1668


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 9/38 (23%), Positives = 20/38 (52%)
 Frame = +2

Query: 137  IKYKWNGLNVGNRLKRSLEMSISHYQSTENR*ARRSGT 250
            +  +W    +G+R++R ++ S  + Q+ E +  R   T
Sbjct: 1627 VALRWRSRYLGDRMQRPMKESQENQQNAETQRERYYAT 1664


>DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 9/22 (40%), Positives = 11/22 (50%)
 Frame = +1

Query: 262 NKI*YTHFTLYMNYNNSYGYIN 327
           NK  + +     NYNN Y Y N
Sbjct: 87  NKTIHNNNNYKYNYNNKYNYNN 108


>DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 21.4 bits (43), Expect = 6.5
 Identities = 7/16 (43%), Positives = 11/16 (68%)
 Frame = +1

Query: 280 HFTLYMNYNNSYGYIN 327
           +++ Y NYNN+Y   N
Sbjct: 90  NYSNYNNYNNNYNNYN 105


>U70841-1|AAC47455.1|  377|Apis mellifera ultraviolet sensitive
           opsin protein.
          Length = 377

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 10/29 (34%), Positives = 15/29 (51%)
 Frame = -1

Query: 156 PFHLYFILKVFHSYCCNFIKKTCIFYFVS 70
           PF +  +LKV+  Y       TC F F++
Sbjct: 184 PFTVLPLLKVWGRYTTEGFLTTCSFDFLT 212


>DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +1

Query: 298 NYNNSYGYINCYNPHD 345
           NYNN+Y   N YN H+
Sbjct: 93  NYNNNY---NNYNKHN 105


>DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +1

Query: 298 NYNNSYGYINCYNPHD 345
           NYNN+Y   N YN H+
Sbjct: 93  NYNNNY---NNYNKHN 105


>DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +1

Query: 298 NYNNSYGYINCYNPHD 345
           NYNN+Y   N YN H+
Sbjct: 93  NYNNNY---NNYNKHN 105


>DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +1

Query: 298 NYNNSYGYINCYNPHD 345
           NYNN+Y   N YN H+
Sbjct: 93  NYNNNY---NNYNKHN 105


>DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +1

Query: 298 NYNNSYGYINCYNPHD 345
           NYNN+Y   N YN H+
Sbjct: 93  NYNNNY---NNYNKHN 105


>DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +1

Query: 298 NYNNSYGYINCYNPHD 345
           NYNN+Y   N YN H+
Sbjct: 93  NYNNNY---NNYNKHN 105


>DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +1

Query: 298 NYNNSYGYINCYNPHD 345
           NYNN+Y   N YN H+
Sbjct: 93  NYNNNY---NNYNKHN 105


>DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +1

Query: 298 NYNNSYGYINCYNPHD 345
           NYNN+Y   N YN H+
Sbjct: 93  NYNNNY---NNYNKHN 105


>DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +1

Query: 298 NYNNSYGYINCYNPHD 345
           NYNN+Y   N YN H+
Sbjct: 93  NYNNNY---NNYNKHN 105


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +1

Query: 298 NYNNSYGYINCYNPHD 345
           NYNN+Y   N YN H+
Sbjct: 326 NYNNNY---NNYNKHN 338


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +1

Query: 298 NYNNSYGYINCYNPHD 345
           NYNN+Y   N YN H+
Sbjct: 326 NYNNNY---NNYNKHN 338


>AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter
           transporter-1A protein.
          Length = 203

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 7/14 (50%), Positives = 9/14 (64%)
 Frame = +1

Query: 304 NNSYGYINCYNPHD 345
           NN +   NC NP+D
Sbjct: 102 NNYWNTKNCVNPYD 115


>AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex
           determiner protein.
          Length = 428

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 10/34 (29%), Positives = 15/34 (44%)
 Frame = +1

Query: 211 SIDRKSLGPTFRYIIKYNKI*YTHFTLYMNYNNS 312
           S+  K++     Y   YN   Y +     NYNN+
Sbjct: 317 SLSNKTIHNNNNYKYNYNNNNYNNNNYNNNYNNN 350


>AF004168-1|AAC13417.1|  377|Apis mellifera blue-sensitive opsin
           protein.
          Length = 377

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 10/29 (34%), Positives = 15/29 (51%)
 Frame = -1

Query: 156 PFHLYFILKVFHSYCCNFIKKTCIFYFVS 70
           PF +  +LKV+  Y       TC F F++
Sbjct: 184 PFTVLPLLKVWGRYTTEGFLTTCSFDFLT 212


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 165,399
Number of Sequences: 438
Number of extensions: 3618
Number of successful extensions: 31
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 30
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 16317903
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).