SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0007
         (555 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamat...    23   2.1  
AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamat...    23   2.1  
AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex det...    22   3.6  
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        22   4.8  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        22   4.8  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        22   4.8  
AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor typ...    22   4.8  
DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex det...    21   6.3  

>AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamate
           receptor 1 protein.
          Length = 843

 Score = 23.0 bits (47), Expect = 2.1
 Identities = 8/36 (22%), Positives = 19/36 (52%)
 Frame = -2

Query: 455 FYQNPLEILKTCRVTHMTFLSQKLFLRVALKVHKQY 348
           FY +  +++  C +  M+FL  +L+  + + +   Y
Sbjct: 656 FYPDRKQVILKCNIQDMSFLFSQLYNALLILISTVY 691


>AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 933

 Score = 23.0 bits (47), Expect = 2.1
 Identities = 8/36 (22%), Positives = 19/36 (52%)
 Frame = -2

Query: 455 FYQNPLEILKTCRVTHMTFLSQKLFLRVALKVHKQY 348
           FY +  +++  C +  M+FL  +L+  + + +   Y
Sbjct: 746 FYPDRKQVILKCNIQDMSFLFSQLYNALLILISTVY 781


>AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex
           determiner protein.
          Length = 413

 Score = 22.2 bits (45), Expect = 3.6
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = -3

Query: 364 KYTSNT*KRQYYIKHYLIN 308
           KY  N   ++ Y K+Y+IN
Sbjct: 330 KYNYNNYNKKLYYKNYIIN 348


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 7/22 (31%), Positives = 12/22 (54%)
 Frame = -1

Query: 429 EDMSGNAYDVFKPETFLKSCPQ 364
           +D SG  + +  PE + K C +
Sbjct: 27  QDSSGRIFTICVPEIYSKECDE 48


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 7/22 (31%), Positives = 12/22 (54%)
 Frame = -1

Query: 429 EDMSGNAYDVFKPETFLKSCPQ 364
           +D SG  + +  PE + K C +
Sbjct: 27  QDSSGRIFTICVPEIYSKECDE 48


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 7/22 (31%), Positives = 12/22 (54%)
 Frame = -1

Query: 429 EDMSGNAYDVFKPETFLKSCPQ 364
           +D SG  + +  PE + K C +
Sbjct: 27  QDSSGRIFTICVPEIYSKECDE 48


>AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor type
           D2 protein.
          Length = 456

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 7/18 (38%), Positives = 11/18 (61%)
 Frame = -2

Query: 80  SCAPVGTGRYYRPAYYCR 27
           +C P    R Y+PA+ C+
Sbjct: 407 ACCPGRVRRRYQPAFRCK 424


>DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 21.4 bits (43), Expect = 6.3
 Identities = 7/18 (38%), Positives = 12/18 (66%)
 Frame = -3

Query: 361 YTSNT*KRQYYIKHYLIN 308
           Y +N   ++ Y K+Y+IN
Sbjct: 106 YNNNNYNKKLYYKNYIIN 123


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 142,561
Number of Sequences: 438
Number of extensions: 2969
Number of successful extensions: 9
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15949830
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).