SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0006
         (600 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1 p...    22   4.0  
DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride c...    22   5.3  
DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride c...    22   5.3  
AB073998-1|BAC76402.1|  339|Apis mellifera preprotachykinin prot...    22   5.3  
AB073995-1|BAC76399.1|  301|Apis mellifera preprotachykinin prot...    22   5.3  
AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C prot...    21   7.0  
AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    21   9.2  
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          21   9.2  
AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.    21   9.2  
AB086196-1|BAD06465.1|  289|Apis mellifera Period protein.             21   9.2  
AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.     21   9.2  

>Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1
           protein.
          Length = 402

 Score = 22.2 bits (45), Expect = 4.0
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = +1

Query: 415 PQPQGHREKDDPYHVS 462
           P+PQ   +   PYHVS
Sbjct: 251 PKPQTKTKPTSPYHVS 266


>DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 6/14 (42%), Positives = 10/14 (71%)
 Frame = -1

Query: 468 CFGNMIWVIFLSVA 427
           CF  M W+I+L ++
Sbjct: 418 CFNLMYWIIYLHIS 431


>DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 6/14 (42%), Positives = 10/14 (71%)
 Frame = -1

Query: 468 CFGNMIWVIFLSVA 427
           CF  M W+I+L ++
Sbjct: 418 CFNLMYWIIYLHIS 431


>AB073998-1|BAC76402.1|  339|Apis mellifera preprotachykinin
           protein.
          Length = 339

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 13/45 (28%), Positives = 20/45 (44%)
 Frame = +1

Query: 196 KAPPSGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDD 330
           K  P G  G  G + +L   E   KRG +  +  ++    T +DD
Sbjct: 180 KRAPMGFYGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDD 224


>AB073995-1|BAC76399.1|  301|Apis mellifera preprotachykinin
           protein.
          Length = 301

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 13/45 (28%), Positives = 20/45 (44%)
 Frame = +1

Query: 196 KAPPSGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDD 330
           K  P G  G  G + +L   E   KRG +  +  ++    T +DD
Sbjct: 180 KRAPMGFYGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDD 224


>AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C
           protein.
          Length = 149

 Score = 21.4 bits (43), Expect = 7.0
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +2

Query: 131 GMCKAGFAGD 160
           GMCK G +GD
Sbjct: 130 GMCKEGISGD 139


>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 8/18 (44%), Positives = 10/18 (55%)
 Frame = -3

Query: 190 DRGEHGARSIISCETGLA 137
           D GEH   ++   E GLA
Sbjct: 130 DPGEHNGDTVTDVEAGLA 147


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 9/48 (18%), Positives = 19/48 (39%)
 Frame = +1

Query: 367 LGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTV 510
           LG+ P G+   +  G    +GH  +   +H     +T       ++ +
Sbjct: 376 LGLMPSGSSVHSDSGENNSRGHSGQSSSHHHGSKSWTQEDMDAALEAL 423


>AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.
          Length = 355

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 10/22 (45%), Positives = 10/22 (45%)
 Frame = +2

Query: 401 LTEAPLNPKATERKMTHIMFPK 466
           LT  P N   T R   HI  PK
Sbjct: 267 LTFCPTNLGTTVRASVHIKLPK 288


>AB086196-1|BAD06465.1|  289|Apis mellifera Period protein.
          Length = 289

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 8/18 (44%), Positives = 10/18 (55%)
 Frame = -3

Query: 190 DRGEHGARSIISCETGLA 137
           D GEH   ++   E GLA
Sbjct: 125 DPGEHNGDTVTDVEAGLA 142


>AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.
          Length = 388

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 15/45 (33%), Positives = 20/45 (44%)
 Frame = -3

Query: 286 GSGNLFCSVPHSYIRVLLSHTDHHALMAGPSHDRGEHGARSIISC 152
           GS  +   VP    RVLL+ TD   +    S D  E+G     +C
Sbjct: 329 GSNYMQTRVPAWCDRVLLNPTDKMLVQDISSPDAVEYGIIGPTTC 373


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 201,371
Number of Sequences: 438
Number of extensions: 5173
Number of successful extensions: 12
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17604432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).