SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0004
         (637 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             22   4.3  
U70841-1|AAC47455.1|  377|Apis mellifera ultraviolet sensitive o...    22   5.7  
AF004168-1|AAC13417.1|  377|Apis mellifera blue-sensitive opsin ...    22   5.7  
AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precur...    21   7.6  
AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C prot...    21   7.6  

>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 22.2 bits (45), Expect = 4.3
 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 1/40 (2%)
 Frame = -1

Query: 559 KNTGSREVPARIPGGTDG-RRTARSTGLNAKRTWRGVLNV 443
           K+ GSRE P      TDG +       L+     +G+L V
Sbjct: 319 KDRGSREYPTSNATDTDGTKERTEEVALDRTPVTQGLLRV 358


>U70841-1|AAC47455.1|  377|Apis mellifera ultraviolet sensitive
           opsin protein.
          Length = 377

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = +1

Query: 496 LYAFRPYHPVFVLGLPGNR 552
           L A+ PY  V ++G+ GNR
Sbjct: 292 LLAWTPYATVALIGVYGNR 310


>AF004168-1|AAC13417.1|  377|Apis mellifera blue-sensitive opsin
           protein.
          Length = 377

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = +1

Query: 496 LYAFRPYHPVFVLGLPGNR 552
           L A+ PY  V ++G+ GNR
Sbjct: 292 LLAWTPYATVALIGVYGNR 310


>AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precursor
           protein.
          Length = 405

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 6/11 (54%), Positives = 7/11 (63%)
 Frame = -2

Query: 582 VKWGTGCGKTP 550
           + WG  CGK P
Sbjct: 369 ISWGAECGKYP 379


>AB013288-1|BAA87894.1|  149|Apis mellifera protein kinase C
           protein.
          Length = 149

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +3

Query: 111 GMCKAGFAGD 140
           GMCK G +GD
Sbjct: 130 GMCKEGISGD 139


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 211,868
Number of Sequences: 438
Number of extensions: 5324
Number of successful extensions: 9
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19071468
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).