SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0002
         (607 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein p...    97   1e-22
AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein...    72   4e-15
DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.           70   2e-14
DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protei...    58   9e-11
DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly pro...    49   3e-08
AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly pro...    46   2e-07
Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein RJP...    46   3e-07
D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.         43   2e-06
AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly pro...    43   2e-06
AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly pro...    43   2e-06
AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cycl...    24   1.3  
AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly pro...    23   1.8  
DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    22   4.1  
DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase ...    22   5.4  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    22   5.4  
AF134818-1|AAD40234.1|  130|Apis mellifera lambda crystallin-lik...    22   5.4  
EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.          21   7.1  
EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.      21   7.1  
AB264335-1|BAF44090.1|   87|Apis mellifera ecdysone-induced prot...    21   9.4  

>DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein
           protein.
          Length = 430

 Score = 97.1 bits (231), Expect = 1e-22
 Identities = 43/64 (67%), Positives = 49/64 (76%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPAT 240
           L E F W  +D+ YPD+ SK  A+  G  IPENALPVGIE WRNKLFV+VPRWR+GIPAT
Sbjct: 34  LLERFFWRTLDYAYPDEASKTMAMMKGEYIPENALPVGIEIWRNKLFVTVPRWRNGIPAT 93

Query: 241 LNYI 252
           L YI
Sbjct: 94  LTYI 97



 Score = 47.6 bits (108), Expect = 9e-08
 Identities = 32/79 (40%), Positives = 40/79 (50%), Gaps = 2/79 (2%)
 Frame = +3

Query: 252 SLDAPYEPSPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWVFRRLAL-MDTTTL 428
           SLD     SPKLTPYP++  N+ G         Y  + AD CDRLWV     + +  TT+
Sbjct: 98  SLDTNRGGSPKLTPYPNWAQNKAGACGSAITTAYR-IHADSCDRLWVLDTGTIGIGNTTI 156

Query: 429 PNGVAPYTLKCF-LTLNNL 482
                PYTL  F LT + L
Sbjct: 157 Q--ACPYTLNIFDLTSDKL 173


>AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein
           protein.
          Length = 411

 Score = 72.1 bits (169), Expect = 4e-15
 Identities = 23/64 (35%), Positives = 47/64 (73%)
 Frame = +1

Query: 58  KLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPA 237
           +++ I+SWNV+++N+P+   +   +  G  I EN +P G++ W +K+F+++PRW++G+P+
Sbjct: 17  EIKTIYSWNVIEYNFPNDNIRNTLISNGDYIEENNMPNGMQIWNDKVFITIPRWKNGVPS 76

Query: 238 TLNY 249
            LN+
Sbjct: 77  NLNF 80



 Score = 39.1 bits (87), Expect = 3e-05
 Identities = 17/38 (44%), Positives = 24/38 (63%)
 Frame = +3

Query: 276 SPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLW 389
           SPKL PYP++E N++ K+     +    V+ D CDRLW
Sbjct: 89  SPKLNPYPNWEMNDINKIDSI--INIIRVRVDACDRLW 124


>DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.
          Length = 552

 Score = 70.1 bits (164), Expect = 2e-14
 Identities = 24/65 (36%), Positives = 45/65 (69%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPAT 240
           ++ +++W+ +D+ Y    ++  A+  G  I EN LP+G+E WR+K+F+++P+W+ GIP T
Sbjct: 154 MELVYAWSTIDYTYDSIEARDSAIFDGDFITENNLPLGLEVWRDKVFITLPKWKDGIPVT 213

Query: 241 LNYIP 255
           L  +P
Sbjct: 214 LTTVP 218



 Score = 35.5 bits (78), Expect = 4e-04
 Identities = 15/39 (38%), Positives = 24/39 (61%)
 Frame = +3

Query: 276 SPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWV 392
           SPKL PYP++E + +G       +    ++ D+CDRLW+
Sbjct: 225 SPKLRPYPNWEWHTVGNCDGLTSVF--RIQVDECDRLWI 261


>DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protein
           protein.
          Length = 424

 Score = 57.6 bits (133), Expect = 9e-11
 Identities = 23/74 (31%), Positives = 50/74 (67%), Gaps = 4/74 (5%)
 Frame = +1

Query: 43  ASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERW----RNKLFVSV 210
           + A  KL+ I+SW  +++ +P+ ++K  A+++G+ IP  +LP+ ++ +    ++ +FV++
Sbjct: 18  SQAQEKLKNIYSWKALEFAFPNGYAKLAAIKSGSYIPGASLPIDVDVYNTEQQSTVFVAI 77

Query: 211 PRWRSGIPATLNYI 252
           PR + G+P TL Y+
Sbjct: 78  PRIQDGVPLTLGYV 91


>DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly
           protein 9 protein.
          Length = 423

 Score = 49.2 bits (112), Expect = 3e-08
 Identities = 19/60 (31%), Positives = 36/60 (60%)
 Frame = +1

Query: 73  FSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           + W   D+N+     +Q A+++G    +N +P+ ++RW  K FV++ R   G+P++LN I
Sbjct: 36  YQWKYFDYNFGSDEKRQAAIQSGEYNYKNNVPIDVDRWNGKTFVTILR-NDGVPSSLNVI 94



 Score = 25.4 bits (53), Expect = 0.44
 Identities = 17/60 (28%), Positives = 28/60 (46%)
 Frame = +3

Query: 279 PKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWVFRRLALMDTTTLPNGVAPYTLK 458
           P L PYP++   +    S     +Y  +  D+ DRLWV       +T+  P+ +  + LK
Sbjct: 103 PLLEPYPNWSWAKNQNCSGIT-SVYR-IAIDEWDRLWVLDNGISGETSVCPSQIVVFDLK 160


>AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly
           protein MRJP5 protein.
          Length = 598

 Score = 46.4 bits (105), Expect = 2e-07
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +1

Query: 70  IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNY 249
           I  W  +D+++     +Q A+++G        P  +++WR   FV+VPR++ G+P++LN 
Sbjct: 38  IHEWKYLDYDFGSDERRQAAMQSGEYDHTKNYPFDVDQWRGMTFVTVPRYK-GVPSSLNV 96

Query: 250 I 252
           I
Sbjct: 97  I 97


>Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein
           RJP57-1 protein.
          Length = 544

 Score = 46.0 bits (104), Expect = 3e-07
 Identities = 17/64 (26%), Positives = 38/64 (59%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPAT 240
           ++ I+ W  +D+++     +  A+++G        P  ++RWR+K FV++ R  +G+P++
Sbjct: 37  MKVIYEWKHIDFDFGSDERRDAAIKSGEFDHTKNYPFDVDRWRDKTFVTIER-NNGVPSS 95

Query: 241 LNYI 252
           LN +
Sbjct: 96  LNVV 99


>D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.
          Length = 432

 Score = 43.2 bits (97), Expect = 2e-06
 Identities = 18/61 (29%), Positives = 37/61 (60%)
 Frame = +1

Query: 70  IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNY 249
           +  W   D+++     +Q A+ +G    +N  P  I++W +K+FV++ R+ +G+P++LN 
Sbjct: 34  LHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRY-NGVPSSLNV 92

Query: 250 I 252
           I
Sbjct: 93  I 93



 Score = 24.2 bits (50), Expect = 1.0
 Identities = 20/75 (26%), Positives = 32/75 (42%)
 Frame = +3

Query: 279 PKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWVFRRLALMDTTTLPNGVAPYTLK 458
           P L PYP +   +    S    +  + +  D+CDRLWV         + L N   P    
Sbjct: 102 PLLQPYPDWSFAKYDDCSGI--VSASKLAIDKCDRLWVL-------DSGLVNNTQPMCSP 152

Query: 459 CFLTLNNLNSKLIRK 503
             LT +   S+L+++
Sbjct: 153 KLLTFDLTTSQLLKQ 167


>AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 43.2 bits (97), Expect = 2e-06
 Identities = 18/61 (29%), Positives = 37/61 (60%)
 Frame = +1

Query: 70  IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNY 249
           +  W   D+++     +Q A+ +G    +N  P  I++W +K+FV++ R+ +G+P++LN 
Sbjct: 34  LHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRY-NGVPSSLNV 92

Query: 250 I 252
           I
Sbjct: 93  I 93



 Score = 24.2 bits (50), Expect = 1.0
 Identities = 20/75 (26%), Positives = 32/75 (42%)
 Frame = +3

Query: 279 PKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWVFRRLALMDTTTLPNGVAPYTLK 458
           P L PYP +   +    S    +  + +  D+CDRLWV         + L N   P    
Sbjct: 102 PLLQPYPDWSFAKYDDCSGI--VSASKLAIDKCDRLWVL-------DSGLVNNTQPMCSP 152

Query: 459 CFLTLNNLNSKLIRK 503
             LT +   S+L+++
Sbjct: 153 KLLTFDLTTSQLLKQ 167


>AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 43.2 bits (97), Expect = 2e-06
 Identities = 18/61 (29%), Positives = 37/61 (60%)
 Frame = +1

Query: 70  IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNY 249
           +  W   D+++     +Q A+ +G    +N  P  I++W +K+FV++ R+ +G+P++LN 
Sbjct: 34  LHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRY-NGVPSSLNV 92

Query: 250 I 252
           I
Sbjct: 93  I 93



 Score = 24.2 bits (50), Expect = 1.0
 Identities = 20/75 (26%), Positives = 32/75 (42%)
 Frame = +3

Query: 279 PKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWVFRRLALMDTTTLPNGVAPYTLK 458
           P L PYP +   +    S    +  + +  D+CDRLWV         + L N   P    
Sbjct: 102 PLLQPYPDWSFAKYDDCSGI--VSASKLAIDKCDRLWVL-------DSGLVNNTQPMCSP 152

Query: 459 CFLTLNNLNSKLIRK 503
             LT +   S+L+++
Sbjct: 153 KLLTFDLTTSQLLKQ 167


>AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cyclase
           beta-3 protein.
          Length = 832

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 10/36 (27%), Positives = 20/36 (55%)
 Frame = -1

Query: 403 KRLNTQRRSHWSALTPVYRSQSCFDNLPNSLPSKLG 296
           KR++    + ++  T +Y +Q+C D   +   SK+G
Sbjct: 623 KRVSAGTPAAFNISTTIYENQNCLDASSSRRGSKIG 658


>AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly
           protein 8 protein.
          Length = 416

 Score = 23.4 bits (48), Expect = 1.8
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +3

Query: 360 VKADQCDRLWV 392
           ++ D CDRLWV
Sbjct: 125 IEIDMCDRLWV 135


>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = -1

Query: 202 RTICSSTFRYQRAVRSLVSEHQS 134
           R+I SS  RY R++     +HQ+
Sbjct: 379 RSIYSSLLRYPRSIFRQTDDHQN 401


>DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase
           isoform B protein.
          Length = 931

 Score = 21.8 bits (44), Expect = 5.4
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%)
 Frame = +1

Query: 109 QFSKQQALRTGALIPENALPV--GIERW 186
           Q SK +A+    LI  + LPV  G+ RW
Sbjct: 34  QDSKAKAIVVNTLISNDILPVCNGLWRW 61


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
           isoform A protein.
          Length = 969

 Score = 21.8 bits (44), Expect = 5.4
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%)
 Frame = +1

Query: 109 QFSKQQALRTGALIPENALPV--GIERW 186
           Q SK +A+    LI  + LPV  G+ RW
Sbjct: 72  QDSKAKAIVVNTLISNDILPVCNGLWRW 99


>AF134818-1|AAD40234.1|  130|Apis mellifera lambda crystallin-like
           protein protein.
          Length = 130

 Score = 21.8 bits (44), Expect = 5.4
 Identities = 9/24 (37%), Positives = 12/24 (50%)
 Frame = +3

Query: 267 YEPSPKLTPYPSFEGNELGKLSKQ 338
           Y+ S    P P FEG    K+S +
Sbjct: 75  YDVSMTFGPVPKFEGEMAEKISNE 98


>EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.
          Length = 684

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 8/25 (32%), Positives = 15/25 (60%)
 Frame = +3

Query: 408 LMDTTTLPNGVAPYTLKCFLTLNNL 482
           ++D  +  N +   +L CF T+N+L
Sbjct: 547 MLDLNSGLNKITRNSLDCFFTMNDL 571


>EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.
          Length = 684

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 8/25 (32%), Positives = 15/25 (60%)
 Frame = +3

Query: 408 LMDTTTLPNGVAPYTLKCFLTLNNL 482
           ++D  +  N +   +L CF T+N+L
Sbjct: 547 MLDLNSGLNKITRNSLDCFFTMNDL 571


>AB264335-1|BAF44090.1|   87|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 87

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 8/14 (57%), Positives = 9/14 (64%)
 Frame = +2

Query: 164 CPLVSKGGGTNCSS 205
           C L +   GTNCSS
Sbjct: 7   CDLATPRTGTNCSS 20


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 184,667
Number of Sequences: 438
Number of extensions: 4187
Number of successful extensions: 38
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 27
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17848938
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).