BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060107.seq (658 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 25 0.48 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 25 0.48 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 25 0.84 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 24 1.1 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 5.9 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 5.9 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 25.4 bits (53), Expect = 0.48 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 139 YTHLYTLIVKPDNTYEVLIDNEKVES 216 Y H Y + KP N E++ N K+ES Sbjct: 428 YYHSYKMHQKPYNKDEIIYPNLKIES 453 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 25.4 bits (53), Expect = 0.48 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 139 YTHLYTLIVKPDNTYEVLIDNEKVES 216 Y H Y + KP N E++ N K+ES Sbjct: 428 YYHSYKMHQKPYNKDEIIYPNLKIES 453 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 24.6 bits (51), Expect = 0.84 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 537 LIQTCTSATKSALSVSILWQSQVRYHSLDDFPYLLD 644 LIQ+ S + S IL Q +R ++ FPY+ D Sbjct: 433 LIQSQPSPQYPSTSSHILQQPSIRTYTQQQFPYVHD 468 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/26 (34%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -3 Query: 461 PNALV-VWVVNHRWLPFSVHLIIPVF 387 PN +V W+ + R+LP S+ +++ F Sbjct: 796 PNGIVKTWIAHDRYLPNSLRILLKRF 821 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/53 (20%), Positives = 26/53 (49%) Frame = +1 Query: 4 TRETPYEIMFGPDICGPGTKKVHVIFSYKGKNHLIKKDIRCKDDVYTHLYTLI 162 +RE+ ++ + D+ +++ + Y+G + + D +DVY L +I Sbjct: 1037 SRESGFKKTYVQDLIQAEASQIYDMLVYEGGHFYVCGDCTMAEDVYQTLKHII 1089 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 5.9 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +1 Query: 322 KTRSLRIGTSLNTFQIQMPPNLKTGMMRWTENGSHL*LTTQTTRAF 459 K R+ T+LN + PPNL+ R E S + AF Sbjct: 295 KERNGPTQTTLNATTLFCPPNLRLTSERGYEQESKVQFVVDAVYAF 340 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 5.9 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +1 Query: 322 KTRSLRIGTSLNTFQIQMPPNLKTGMMRWTENGSHL*LTTQTTRAF 459 K R+ T+LN + PPNL+ R E S + AF Sbjct: 385 KERNGPTQTTLNATTLFCPPNLRLTSERGYEQESKVQFVVDAVYAF 430 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,534 Number of Sequences: 438 Number of extensions: 4270 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -