BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060103.seq (658 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 25 0.84 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 25 0.84 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 1.9 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.9 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.9 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 21 7.8 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 21 7.8 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 21 7.8 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 21 7.8 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 21 7.8 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 21 7.8 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 21 7.8 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 21 7.8 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 24.6 bits (51), Expect = 0.84 Identities = 19/69 (27%), Positives = 30/69 (43%) Frame = -3 Query: 353 SSKDTAECSVAIVRPNFFVASRSCCTREPRNCSEVTADESVISLPPAQVSSSISHPCTHN 174 S D A + I P V + S + PR S ++ S S PPA+ +++ P N Sbjct: 489 SGYDGAASTAVIHEP--VVETNSSPSPNPRIASAPSSSTS--SSPPAKGAAAAGQPSKRN 544 Query: 173 GNRHHNQSI 147 G + Q + Sbjct: 545 GGETNKQEL 553 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 24.6 bits (51), Expect = 0.84 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 512 NASPQSWTPLILDR 471 NASP +W+P LDR Sbjct: 514 NASPTTWSPADLDR 527 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 17 FYLHFGEMETLNMAKLNLSSVRPHASTESGPKVEV 121 FY+ F ++ ++++ L+ S H S G VE+ Sbjct: 296 FYMAFSKLYSVSVVSLDKSLEVNHISARVGDNVEI 330 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 551 HRTCWPTIHSSCL 513 H C P IH SC+ Sbjct: 477 HSRCPPEIHKSCI 489 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 551 HRTCWPTIHSSCL 513 H C P IH SC+ Sbjct: 477 HSRCPPEIHKSCI 489 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 656 ETNFRMPLSSKSASVHNILSQL 591 +T+ +PLS +H IL +L Sbjct: 384 DTSASLPLSGMQEELHTILKEL 405 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 656 ETNFRMPLSSKSASVHNILSQL 591 +T+ +PLS +H IL +L Sbjct: 384 DTSASLPLSGMQEELHTILKEL 405 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 656 ETNFRMPLSSKSASVHNILSQL 591 +T+ +PLS +H IL +L Sbjct: 384 DTSASLPLSGMQEELHTILKEL 405 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 656 ETNFRMPLSSKSASVHNILSQL 591 +T+ +PLS +H IL +L Sbjct: 384 DTSASLPLSGMQEELHTILKEL 405 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 656 ETNFRMPLSSKSASVHNILSQL 591 +T+ +PLS +H IL +L Sbjct: 384 DTSASLPLSGMQEELHTILKEL 405 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 656 ETNFRMPLSSKSASVHNILSQL 591 +T+ +PLS +H IL +L Sbjct: 384 DTSASLPLSGMQEELHTILKEL 405 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 656 ETNFRMPLSSKSASVHNILSQL 591 +T+ +PLS +H IL +L Sbjct: 452 DTSASLPLSGMQEELHTILKEL 473 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 656 ETNFRMPLSSKSASVHNILSQL 591 +T+ +PLS +H IL +L Sbjct: 452 DTSASLPLSGMQEELHTILKEL 473 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,475 Number of Sequences: 438 Number of extensions: 3231 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -