SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30060
         (824 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g26530.1 68417.m03822 fructose-bisphosphate aldolase, putativ...   115   3e-26
At4g26520.1 68417.m03820 fructose-bisphosphate aldolase, cytopla...   114   6e-26
At2g36460.1 68415.m04475 fructose-bisphosphate aldolase, putativ...   107   9e-24
At3g52930.1 68416.m05834 fructose-bisphosphate aldolase, putativ...   101   6e-22
At2g21330.1 68415.m02538 fructose-bisphosphate aldolase, putativ...   100   2e-21
At4g38970.2 68417.m05522 fructose-bisphosphate aldolase, putativ...    95   5e-20
At4g38970.1 68417.m05521 fructose-bisphosphate aldolase, putativ...    95   5e-20
At2g01140.1 68415.m00023 fructose-bisphosphate aldolase, putativ...    95   5e-20
At5g03690.2 68418.m00329 fructose-bisphosphate aldolase, putativ...    94   1e-19
At5g03690.1 68418.m00328 fructose-bisphosphate aldolase, putativ...    94   1e-19
At3g60240.1 68416.m06732 MIF4G domain-containing protein / MA3 d...    31   0.70 
At2g23140.1 68415.m02763 armadillo/beta-catenin repeat family pr...    30   1.6  
At1g49850.1 68414.m05589 zinc finger (C3HC4-type RING finger) fa...    30   1.6  
At1g13050.1 68414.m01513 expressed protein                             30   1.6  
At3g46840.1 68416.m05084 subtilase family protein contains simil...    29   2.8  
At5g47820.2 68418.m05908 kinesin-like protein (FRA1) identical t...    29   3.7  
At5g47820.1 68418.m05907 kinesin-like protein (FRA1) identical t...    29   3.7  
At3g46850.1 68416.m05085 subtilase family protein contains simil...    29   5.0  
At1g17380.1 68414.m02120 expressed protein                             29   5.0  
At2g43970.2 68415.m05468 La domain-containing protein contains P...    28   6.5  
At2g43970.1 68415.m05467 La domain-containing protein contains P...    28   6.5  
At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase fa...    28   6.5  
At1g31810.1 68414.m03904 formin homology 2 domain-containing pro...    28   6.5  
At1g79280.1 68414.m09242 expressed protein weak similarity to Nu...    28   8.7  
At1g58220.1 68414.m06612 myb family transcription factor contain...    28   8.7  

>At4g26530.1 68417.m03822 fructose-bisphosphate aldolase, putative
           strong similarity to SP|P22197 Fructose-bisphosphate
           aldolase, cytoplasmic isozyme (EC 4.1.2.13) {Arabidopsis
           thaliana}
          Length = 358

 Score =  115 bits (277), Expect = 3e-26
 Identities = 60/121 (49%), Positives = 73/121 (60%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           +SGVILF ETLYQK  DG P V LL + G+IPGIKVDKGVV L G+  E TTQGLD L  
Sbjct: 69  LSGVILFEETLYQKTTDGKPFVELLMENGVIPGIKVDKGVVDLAGTNGETTTQGLDSLGA 128

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCRLLKPEVF 637
           RC +Y K G  FAKWR   +  AT P     ++    LAR    + +      +++PEV 
Sbjct: 129 RCQEYYKAGARFAKWRAVLKIGATEPSELSIQENAKGLARYAI-ICQENGLVPIVEPEVL 187

Query: 638 T 640
           T
Sbjct: 188 T 188



 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 32/52 (61%), Positives = 38/52 (73%)
 Frame = +3

Query: 99  EELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           +EL K A+ I  P KGILAADESTGT+GKR   I VEN E NR+  R+LLF+
Sbjct: 10  DELIKTAKYIATPGKGILAADESTGTIGKRFASINVENIESNRQALRELLFT 61


>At4g26520.1 68417.m03820 fructose-bisphosphate aldolase,
           cytoplasmic identical to SP|P22197 Fructose-bisphosphate
           aldolase, cytoplasmic isozyme (EC 4.1.2.13) {Arabidopsis
           thaliana}
          Length = 358

 Score =  114 bits (275), Expect = 6e-26
 Identities = 59/121 (48%), Positives = 73/121 (60%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           +SGVILF ETLYQK  DG P V LL + G+IPGIKVDKG+V L G+  E TTQGLD L  
Sbjct: 69  LSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKGLVDLAGTNGETTTQGLDSLGA 128

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCRLLKPEVF 637
           RC QY + G  FAKWR   +  AT P     ++    LAR    + +      +++PEV 
Sbjct: 129 RCQQYYEAGARFAKWRAFFKIGATEPSVLSIQEDARVLARYAI-ICQENGLVPIVEPEVL 187

Query: 638 T 640
           T
Sbjct: 188 T 188



 Score = 68.1 bits (159), Expect = 7e-12
 Identities = 32/53 (60%), Positives = 40/53 (75%)
 Frame = +3

Query: 96  QEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           ++EL K A+ I  P +GILAADEST T+GKR   I VENTE NR+ YR+LLF+
Sbjct: 9   EDELIKTAKYIATPGRGILAADESTETIGKRFAGINVENTESNRQAYRELLFT 61


>At2g36460.1 68415.m04475 fructose-bisphosphate aldolase, putative
           similar to PIR|S65073 fructose-bisphosphate aldolase (EC
           4.1.2.13) isoenzyme C-1, cytosolic [Oryza sativa];
           contains Pfam profile PF00274 Fructose-bisphosphate
           aldolase class-I
          Length = 358

 Score =  107 bits (257), Expect = 9e-24
 Identities = 51/100 (51%), Positives = 62/100 (62%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           +SGVILF ETLYQK+ DGTP V +L+  G++PGIKVDKG V L G+  E TTQGLD L  
Sbjct: 69  LSGVILFEETLYQKSSDGTPFVDMLKSAGVLPGIKVDKGTVELAGTNGETTTQGLDGLGD 128

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RC +Y + G  FAKWR   +     P      +    LAR
Sbjct: 129 RCKKYYEAGARFAKWRAVLKIGVNEPSQLAIHENAYGLAR 168



 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 34/57 (59%), Positives = 39/57 (68%)
 Frame = +3

Query: 84  TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           T +  +EL   A  I  P KGILAADESTGT+GKRL  I VEN E NRR  R+LLF+
Sbjct: 5   TSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLFT 61


>At3g52930.1 68416.m05834 fructose-bisphosphate aldolase, putative
           similar to SP|O65735|ALF_CICAR Fructose-bisphosphate
           aldolase, cytoplasmic isozyme {Cicer arietinum},
           cytosolic aldolase [Fragaria x ananassa] GI:10645188;
           contains Pfam profile PF00274 Fructose-bisphosphate
           aldolase class-I
          Length = 358

 Score =  101 bits (242), Expect = 6e-22
 Identities = 49/100 (49%), Positives = 62/100 (62%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           +SGVILF ETLYQK+ DG   V +L++ G++PGIKVDKG V L G++ E TTQGLD L  
Sbjct: 69  LSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTDGETTTQGLDGLGD 128

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RC +Y + G  FAKWR   +     P      +    LAR
Sbjct: 129 RCKKYYEAGARFAKWRAVLKIGENEPSEHSIHENAYGLAR 168



 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 34/57 (59%), Positives = 39/57 (68%)
 Frame = +3

Query: 84  TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           T +  +EL   A  I  P KGILAADESTGT+GKRL  I VEN E NRR  R+LLF+
Sbjct: 5   TSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRNLRELLFT 61


>At2g21330.1 68415.m02538 fructose-bisphosphate aldolase, putative
           strong similarity to plastidic fructose-bisphosphate
           aldolase (EC 4.1.2.13) from Nicotiana paniculata
           (NPALDP1) [GI:4827251], Oryza sativa, PIR2:T02057
           [SP|Q40677]
          Length = 399

 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 55/123 (44%), Positives = 72/123 (58%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           L + ISG ILF ETLYQ   DG  +V +L ++ I+PGIKVDKG+VPL GS DE   QGLD
Sbjct: 109 LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLVGSYDESWCQGLD 168

Query: 446 DLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCRLLK 625
            LA R A Y + G  FAKWR    S    P     ++    LAR    +S+ +    +++
Sbjct: 169 GLASRTAAYYQQGARFAKWRTV-VSIPNGPSALAVKEAAWGLARYA-AISQDSGLVPIVE 226

Query: 626 PEV 634
           PE+
Sbjct: 227 PEI 229



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 30/52 (57%), Positives = 36/52 (69%)
 Frame = +3

Query: 99  EELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           +EL K A+ I +P  GI+A DES  T GKRL  IG+ENTE NR+ YR LL S
Sbjct: 54  DELVKTAKTIASPGHGIMAMDESNATCGKRLASIGLENTEANRQAYRTLLVS 105


>At4g38970.2 68417.m05522 fructose-bisphosphate aldolase, putative
           strong similarity to plastidic fructose-bisphosphate
           aldolase (EC 4.1.2.13) from Nicotiana paniculata
           (NPALDP1) [GI:4827251], Oryza sativa, PIR2:T02057
           [SP|Q40677]
          Length = 381

 Score = 95.1 bits (226), Expect = 5e-20
 Identities = 51/123 (41%), Positives = 72/123 (58%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           L + +SG ILF ETLYQ   +G  +V +L ++ I+PGIKVDKG+VPL GS +E   QGLD
Sbjct: 108 LGQYVSGAILFEETLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWCQGLD 167

Query: 446 DLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCRLLK 625
            L+ R A Y + G  FAKWR    S    P     ++    LAR    +S+ +    +++
Sbjct: 168 GLSSRTAAYYQQGARFAKWRTV-VSIPNGPSALAVKEAAWGLARYA-AISQDSGLVPIVE 225

Query: 626 PEV 634
           PE+
Sbjct: 226 PEI 228



 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/52 (57%), Positives = 37/52 (71%)
 Frame = +3

Query: 99  EELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           +EL K A+ I +P +GILA DES  T GKRL  IG+ENTE NR+ +R LL S
Sbjct: 53  DELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAFRTLLVS 104


>At4g38970.1 68417.m05521 fructose-bisphosphate aldolase, putative
           strong similarity to plastidic fructose-bisphosphate
           aldolase (EC 4.1.2.13) from Nicotiana paniculata
           (NPALDP1) [GI:4827251], Oryza sativa, PIR2:T02057
           [SP|Q40677]
          Length = 398

 Score = 95.1 bits (226), Expect = 5e-20
 Identities = 51/123 (41%), Positives = 72/123 (58%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           L + +SG ILF ETLYQ   +G  +V +L ++ I+PGIKVDKG+VPL GS +E   QGLD
Sbjct: 108 LGQYVSGAILFEETLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWCQGLD 167

Query: 446 DLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCRLLK 625
            L+ R A Y + G  FAKWR    S    P     ++    LAR    +S+ +    +++
Sbjct: 168 GLSSRTAAYYQQGARFAKWRTV-VSIPNGPSALAVKEAAWGLARYA-AISQDSGLVPIVE 225

Query: 626 PEV 634
           PE+
Sbjct: 226 PEI 228



 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 30/52 (57%), Positives = 37/52 (71%)
 Frame = +3

Query: 99  EELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           +EL K A+ I +P +GILA DES  T GKRL  IG+ENTE NR+ +R LL S
Sbjct: 53  DELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAFRTLLVS 104


>At2g01140.1 68415.m00023 fructose-bisphosphate aldolase, putative
           similar to plastidic aldolase NPALDP1 from Nicotiana
           paniculata [GI:4827251]; contains Pfam profile PF00274
           Fructose-bisphosphate aldolase class-I
          Length = 391

 Score = 95.1 bits (226), Expect = 5e-20
 Identities = 46/80 (57%), Positives = 51/80 (63%)
 Frame = +2

Query: 266 LSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLD 445
           L + ISG ILF ETLYQ   DG   V  L    I+PGIKVDKG+ PL GS +E   QGLD
Sbjct: 101 LGDYISGSILFEETLYQSTKDGKTFVDCLRDANIVPGIKVDKGLSPLAGSNEESWCQGLD 160

Query: 446 DLAQRCAQYKKDGCHFAKWR 505
            LA R A+Y K G  FAKWR
Sbjct: 161 GLASRSAEYYKQGARFAKWR 180



 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 30/52 (57%), Positives = 40/52 (76%)
 Frame = +3

Query: 99  EELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           +EL K A++I +P +GILA DES  T GKRL  IG++NTE+NR+ YRQLL +
Sbjct: 46  DELVKTAKSIASPGRGILAIDESNATCGKRLASIGLDNTEDNRQAYRQLLLT 97


>At5g03690.2 68418.m00329 fructose-bisphosphate aldolase, putative
           similar to PIR|S65073 fructose-bisphosphate aldolase (EC
           4.1.2.13) isoenzyme C-1, cytosolic [Oryza sativa];
           contains Pfam profile PF00274 Fructose-bisphosphate
           aldolase class-I
          Length = 359

 Score = 93.9 bits (223), Expect = 1e-19
 Identities = 46/100 (46%), Positives = 58/100 (58%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           ISG+ILF ETLYQK   G   V ++++ G++PGIKVDKG V L G+  E TT GLD L  
Sbjct: 69  ISGIILFEETLYQKTASGKLFVDVMKEAGVLPGIKVDKGTVELAGTNGETTTTGLDGLGD 128

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RC +Y + G  FAKWR   +     P      +    LAR
Sbjct: 129 RCKKYYEAGARFAKWRAVLKIGNNEPSELAIHENAYGLAR 168



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 32/52 (61%), Positives = 36/52 (69%)
 Frame = +3

Query: 99  EELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           +EL   A  I  P KGILAADESTGT+GKR   I VEN E NRR  R+LLF+
Sbjct: 10  DELIANAAYIGTPGKGILAADESTGTIGKRFVSINVENVESNRRALRELLFT 61


>At5g03690.1 68418.m00328 fructose-bisphosphate aldolase, putative
           similar to PIR|S65073 fructose-bisphosphate aldolase (EC
           4.1.2.13) isoenzyme C-1, cytosolic [Oryza sativa];
           contains Pfam profile PF00274 Fructose-bisphosphate
           aldolase class-I
          Length = 393

 Score = 93.9 bits (223), Expect = 1e-19
 Identities = 46/100 (46%), Positives = 58/100 (58%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           ISG+ILF ETLYQK   G   V ++++ G++PGIKVDKG V L G+  E TT GLD L  
Sbjct: 103 ISGIILFEETLYQKTASGKLFVDVMKEAGVLPGIKVDKGTVELAGTNGETTTTGLDGLGD 162

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RC +Y + G  FAKWR   +     P      +    LAR
Sbjct: 163 RCKKYYEAGARFAKWRAVLKIGNNEPSELAIHENAYGLAR 202



 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 32/51 (62%), Positives = 35/51 (68%)
 Frame = +3

Query: 102 ELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLFS 254
           EL   A  I  P KGILAADESTGT+GKR   I VEN E NRR  R+LLF+
Sbjct: 45  ELIANAAYIGTPGKGILAADESTGTIGKRFVSINVENVESNRRALRELLFT 95


>At3g60240.1 68416.m06732 MIF4G domain-containing protein / MA3
            domain-containing protein similar to eukaryotic protein
            synthesis initiation factor [Homo sapiens] GI:3941724;
            contains Pfam profiles PF02854: MIF4G domain, PF02847:
            MA3 domain
          Length = 1544

 Score = 31.5 bits (68), Expect = 0.70
 Identities = 31/111 (27%), Positives = 48/111 (43%), Gaps = 4/111 (3%)
 Frame = +1

Query: 388  QGCRPAVRIGRRMHHPGSGRPRPALR-PVQEGRL---PLRQVALLLKIGRNTPSYQAIQE 555
            QG  PA   G     PG G     LR P  +G +   P++ V  +  +GRNTP  +  Q 
Sbjct: 814  QGSLPAGYGGNVGFRPGQGGNSGVLRNPRMQGPIISRPMQPVGPMGGMGRNTPDLERWQR 873

Query: 556  NANVSRPLTLPSVRANAFVPIVEARSLYLMGEARTLEPRPRKVNLKVVLGR 708
             +N  +    PS      V + +A   Y +G     E + ++  LK +L +
Sbjct: 874  GSNFQQKGLFPSPHTPMQV-MHKAERKYQVGTIAD-EEQAKQRQLKSILNK 922


>At2g23140.1 68415.m02763 armadillo/beta-catenin repeat family
           protein / U-box domain-containing protein contains Pfam
           domain, PF00514: Armadillo/beta-catenin-like repeats and
           Pfam, PF04564: U-box domain
          Length = 811

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 2/59 (3%)
 Frame = -1

Query: 611 TNALALTDGSVSGRETL--AFSWIAWYEGVLRPIFSSNATWRSGSRPSCTGRSAGRGRP 441
           T+++  T   VS R+    +  W A      +P FSS AT R G+ PS    + G   P
Sbjct: 323 TDSIPSTGADVSARKVSNKSHDWDASSSETGKPSFSSRATEREGASPSRPASALGASSP 381


>At1g49850.1 68414.m05589 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 250

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 4/41 (9%)
 Frame = +1

Query: 364 HHPRHQGRQGC----RPAVRIGRRMHHPGSGRPRPALRPVQ 474
           HH +     GC    RP  R+ R  HHP   R RP +R VQ
Sbjct: 44  HHNQRHDSDGCDPLRRPTPRLRRFFHHPIQERSRP-IRDVQ 83


>At1g13050.1 68414.m01513 expressed protein
          Length = 317

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 22/65 (33%), Positives = 31/65 (47%)
 Frame = +1

Query: 427 HHPGSGRPRPALRPVQEGRLPLRQVALLLKIGRNTPSYQAIQENANVSRPLTLPSVRANA 606
           H+P S RP   L P +E R P R         R  P+  A Q+    ++P+TLP+    A
Sbjct: 85  HNPNSARPLQ-LSP-EEQRPPHRGYGSEPTPWRRAPTRPAYQQGPKRTKPMTLPATICCA 142

Query: 607 FVPIV 621
            + IV
Sbjct: 143 ILLIV 147


>At3g46840.1 68416.m05084 subtilase family protein contains
           similarity to prepro-cucumisin GI:807698 from [Cucumis
           melo];
          Length = 738

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 18/71 (25%), Positives = 30/71 (42%)
 Frame = -1

Query: 740 VVRLRGLFKTGRPRTTFKLTFLGRGSKVRASPIR*RLRASTIGTNALALTDGSVSGRETL 561
           V+  R +   GRP  T+K   +G   KV+  P    L++     +      G+    E L
Sbjct: 655 VIFRRTVTNVGRPNATYKAKVVGSKLKVKVVPAVLSLKSLYEKKSFTVTASGAGPKAENL 714

Query: 560 AFSWIAWYEGV 528
             + + W +GV
Sbjct: 715 VSAQLIWSDGV 725


>At5g47820.2 68418.m05908 kinesin-like protein (FRA1) identical to
            kinesin-like protein [Arabidopsis thaliana] GI:27260890;
            contains Pfam profile PF00225: Kinesin motor domain
          Length = 1035

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 14/51 (27%), Positives = 25/51 (49%)
 Frame = +1

Query: 463  RPVQEGRLPLRQVALLLKIGRNTPSYQAIQENANVSRPLTLPSVRANAFVP 615
            R   E  L LR+ A+   +G    S + + E+ +   P+T+P+ +   F P
Sbjct: 894  RKEAEKELKLREQAIATSLGTPPSSVKHVAEDLSTPSPMTVPAQKQLKFTP 944


>At5g47820.1 68418.m05907 kinesin-like protein (FRA1) identical to
            kinesin-like protein [Arabidopsis thaliana] GI:27260890;
            contains Pfam profile PF00225: Kinesin motor domain
          Length = 1035

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 14/51 (27%), Positives = 25/51 (49%)
 Frame = +1

Query: 463  RPVQEGRLPLRQVALLLKIGRNTPSYQAIQENANVSRPLTLPSVRANAFVP 615
            R   E  L LR+ A+   +G    S + + E+ +   P+T+P+ +   F P
Sbjct: 894  RKEAEKELKLREQAIATSLGTPPSSVKHVAEDLSTPSPMTVPAQKQLKFTP 944


>At3g46850.1 68416.m05085 subtilase family protein contains
           similarity to prepro-cucumisin GI:807698 from [Cucumis
           melo];
          Length = 736

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 17/67 (25%), Positives = 28/67 (41%)
 Frame = -1

Query: 728 RGLFKTGRPRTTFKLTFLGRGSKVRASPIR*RLRASTIGTNALALTDGSVSGRETLAFSW 549
           R +   GRP  T+K   +G   KV+  P    L++     +      G+    E L  + 
Sbjct: 659 RTVTNVGRPNATYKAKVVGSKLKVKVVPAVLSLKSLYEKKSFTVTVSGAGPKAENLVSAQ 718

Query: 548 IAWYEGV 528
           + W +GV
Sbjct: 719 LIWSDGV 725


>At1g17380.1 68414.m02120 expressed protein
          Length = 274

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 15/36 (41%), Positives = 21/36 (58%)
 Frame = +2

Query: 179 GKAFAGHRRGEHRGEPSSLSPTPIQPDAVLSENISG 286
           GK  A H+ G  +GEPS+ S   ++  A LSE+  G
Sbjct: 60  GKQNAMHKAGHSKGEPSTSSGGKVKDVADLSESQPG 95


>At2g43970.2 68415.m05468 La domain-containing protein contains Pfam
           profile PF05383: La domain
          Length = 529

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 11/35 (31%), Positives = 16/35 (45%)
 Frame = +1

Query: 352 GEEGHHPRHQGRQGCRPAVRIGRRMHHPGSGRPRP 456
           G   HH  H  + G +P+      M  PG G+ +P
Sbjct: 470 GRGNHHHHHHHQVGTQPSNNPMNNMEQPGMGKQQP 504


>At2g43970.1 68415.m05467 La domain-containing protein contains Pfam
           profile PF05383: La domain
          Length = 545

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 11/35 (31%), Positives = 16/35 (45%)
 Frame = +1

Query: 352 GEEGHHPRHQGRQGCRPAVRIGRRMHHPGSGRPRP 456
           G   HH  H  + G +P+      M  PG G+ +P
Sbjct: 486 GRGNHHHHHHHQVGTQPSNNPMNNMEQPGMGKQQP 520


>At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase
           family protein belongs to Pfam:PF03372:
           Endonuclease/Exonuclease/phosphatase family; contains 3
           WD-40 repeats (PF00400);similar to Type II
           inositol-1,4,5-trisphosphate 5-phosphatase EC 3.1.3.56
           (5PTASE) (INPP5B) (SP:P32019) [Homo sapiens]
          Length = 1305

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 17/59 (28%), Positives = 25/59 (42%)
 Frame = +2

Query: 110 EDRSSNCSSRKGYPRR*RIHRYNGKAFAGHRRGEHRGEPSSLSPTPIQPDAVLSENISG 286
           +D     S+    P   +IH Y+ +  A  ++G HR    SL   P   + V    ISG
Sbjct: 14  DDEEEALSAMSSVPPPRKIHSYSHQLRATGQKGHHRQRQHSLDDIPKITEIVSGCGISG 72


>At1g31810.1 68414.m03904 formin homology 2 domain-containing
           protein / FH2 domain-containing protein low similarity
           to SP|P48608 Diaphanous protein {Drosophila
           melanogaster}; contains Pfam profile PF02181: Formin
           Homology 2(FH2) Domain
          Length = 1201

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 13/42 (30%), Positives = 20/42 (47%)
 Frame = +1

Query: 370 PRHQGRQGCRPAVRIGRRMHHPGSGRPRPALRPVQEGRLPLR 495
           P    + GCRP +RI  R +   SG     +  + + + PLR
Sbjct: 192 PNFDSQHGCRPIIRIFGRNYSSKSGLSTEMVYSMSDKKKPLR 233


>At1g79280.1 68414.m09242 expressed protein weak similarity to
            Nucleoprotein TPR (Swiss-Prot:P12270) [Homo sapiens]
          Length = 2111

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 1/71 (1%)
 Frame = -1

Query: 614  GTNALALTDGSVSGRETLAF-SWIAWYEGVLRPIFSSNATWRSGSRPSCTGRSAGRGRPD 438
            GT+A+ +  GS+   +  A+ S + ++E V R I +SN+   +      T  S+G    +
Sbjct: 1610 GTSAVQVLSGSILNDQAAAYVSAVEYFERVARSI-ASNSQVSTKPTDMVTEPSSGIPAAE 1668

Query: 437  PGWCIRLPIRT 405
            P    R+P  T
Sbjct: 1669 PSTMTRVPSST 1679


>At1g58220.1 68414.m06612 myb family transcription factor contains
           Pfam profile: PF00249: Myb-like DNA-binding domain
          Length = 834

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 14/59 (23%), Positives = 27/59 (45%)
 Frame = -3

Query: 549 DSLVRGGVAADLQQQRHLAKWQPSFLYWAQRWARSSRPWVVHSSSDPNSGTTPLSTLMP 373
           DS V   +  ++    H    +PS  YW+ R    + P  +  +++ ++G    S+L P
Sbjct: 133 DSTVEAPLTINIPYSLHRGPQEPSDSYWSSRGMNITFPVFLPKAAEGHNGNGLASSLAP 191


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,779,618
Number of Sequences: 28952
Number of extensions: 467370
Number of successful extensions: 1271
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 1202
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1265
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1892353600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).