SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30055
         (803 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g46460.1 68416.m05037 ubiquitin-conjugating enzyme 13 (UBC13)...    54   8e-08
At3g55380.1 68416.m06151 ubiquitin-conjugating enzyme 14 (UBC14)...    52   4e-07
At3g17000.1 68416.m02171 ubiquitin-conjugating enzyme, putative ...    39   0.004
At5g59300.1 68418.m07430 ubiquitin-conjugating enzyme 7 (UBC7) E...    38   0.006
At5g25760.1 68418.m03057 ubiquitin-conjugating enzyme, putative ...    38   0.010
At5g50430.1 68418.m06245 ubiquitin-conjugating enzyme, putative ...    36   0.024
At1g17280.1 68414.m02105 ubiquitin-conjugating enzyme, putative ...    36   0.024
At5g62540.1 68418.m07849 ubiquitin-conjugating enzyme 3 (UBC3) E...    34   0.096
At4g36410.1 68417.m05173 ubiquitin-conjugating enzyme 17 (UBC17)...    34   0.096
At1g45050.1 68414.m05165 ubiquitin-conjugating enzyme 15 (UBC15)...    34   0.096
At2g16740.1 68415.m01920 ubiquitin-conjugating enzyme, putative ...    34   0.13 
At3g08690.1 68416.m01010 ubiquitin-conjugating enzyme 11 (UBC11)...    33   0.17 
At1g75440.1 68414.m08763 ubiquitin-conjugating enzyme 16 (UBC16)...    33   0.17 
At5g41700.4 68418.m05071 ubiquitin-conjugating enzyme 8 (UBC8) E...    33   0.29 
At5g41700.3 68418.m05068 ubiquitin-conjugating enzyme 8 (UBC8) E...    33   0.29 
At5g41700.2 68418.m05070 ubiquitin-conjugating enzyme 8 (UBC8) E...    33   0.29 
At5g41700.1 68418.m05069 ubiquitin-conjugating enzyme 8 (UBC8) E...    33   0.29 
At4g27960.2 68417.m04012 ubiquitin-conjugating enzyme E2-17 kDa ...    33   0.29 
At4g27960.1 68417.m04011 ubiquitin-conjugating enzyme E2-17 kDa ...    33   0.29 
At1g64230.1 68414.m07276 ubiquitin-conjugating enzyme, putative ...    33   0.29 
At3g08700.1 68416.m01011 ubiquitin-conjugating enzyme, putative ...    32   0.51 
At2g02760.1 68415.m00219 ubiquitin-conjugating enzyme 2 (UBC2) E...    32   0.51 
At1g14400.2 68414.m01708 ubiquitin-conjugating enzyme 1 (UBC1) E...    32   0.51 
At1g14400.1 68414.m01707 ubiquitin-conjugating enzyme 1 (UBC1) E...    32   0.51 
At5g56150.2 68418.m07005 ubiquitin-conjugating enzyme, putative ...    31   0.68 
At5g56150.1 68418.m07004 ubiquitin-conjugating enzyme, putative ...    31   0.68 
At5g53300.2 68418.m06625 ubiquitin-conjugating enzyme 10 (UBC10)...    31   0.68 
At5g53300.1 68418.m06624 ubiquitin-conjugating enzyme 10 (UBC10)...    31   0.68 
At5g42990.1 68418.m05243 ubiquitin-conjugating enzyme 18 (UBC18)...    31   0.68 
At3g57870.1 68416.m06451 ubiquitin-conjugating enzyme, putative ...    31   0.90 
At1g36340.1 68414.m04516 ubiquitin-conjugating enzyme family pro...    31   1.2  
At2g32790.1 68415.m04014 ubiquitin-conjugating enzyme, putative ...    29   2.7  
At1g55535.2 68414.m06355 expressed protein                             29   2.7  
At1g55535.1 68414.m06354 expressed protein                             29   2.7  
At5g05080.1 68418.m00539 ubiquitin-conjugating enzyme, putative ...    29   4.8  
At4g10020.1 68417.m01639 short-chain dehydrogenase/reductase (SD...    24   5.6  
At3g20060.1 68416.m02537 ubiquitin-conjugating enzyme 19 (UBC19)...    28   8.3  
At2g33770.1 68415.m04141 ubiquitin-conjugating enzyme family pro...    28   8.3  
At1g50490.1 68414.m05662 ubiquitin-conjugating enzyme 20 (UBC20)...    28   8.3  

>At3g46460.1 68416.m05037 ubiquitin-conjugating enzyme 13 (UBC13)
           E2; identical to gi:992706
          Length = 166

 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 24/48 (50%), Positives = 30/48 (62%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           S A   L  + K L + PV+GF   L+ E N+FEW V I GPPDTLY+
Sbjct: 3   SQACLLLQKQLKDLCKHPVDGFSAGLVDEKNIFEWSVTIIGPPDTLYE 50



 Score = 37.9 bits (84), Expect = 0.008
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNVY +G +CISILHPP
Sbjct: 79  HPNVYPDGRVCISILHPP 96



 Score = 33.5 bits (73), Expect = 0.17
 Identities = 19/55 (34%), Positives = 26/55 (47%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWDDPQSGEL 675
           G+F A M FP +YP SPP++R  +      +Y    +        P DDP   EL
Sbjct: 52  GFFYAIMSFPQNYPNSPPTVRFTSDIWHPNVYPDGRV-CISILHPPGDDPSGYEL 105


>At3g55380.1 68416.m06151 ubiquitin-conjugating enzyme 14 (UBC14)
           E2; UbcAT3; identical to gi:2129757, S46656
          Length = 167

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 21/42 (50%), Positives = 30/42 (71%)
 Frame = +2

Query: 383 LALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           L  + K L ++PV+GF   L+ E N+F+W V+I GPPDTLY+
Sbjct: 10  LQKQLKDLCKKPVDGFSAGLVDEKNVFQWSVSIMGPPDTLYE 51



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNVY +G +CISILHPP
Sbjct: 80  HPNVYSDGKVCISILHPP 97



 Score = 33.5 bits (73), Expect = 0.17
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWDDPQSGEL 675
           G+F A M FP +YP SPP++   +      +Y   ++        P DDP   EL
Sbjct: 53  GFFNAIMSFPENYPVSPPTVTFTSEMWHPNVYSDGKV-CISILHPPGDDPHGYEL 106


>At3g17000.1 68416.m02171 ubiquitin-conjugating enzyme, putative
           similar to Non-Canonical UBiquitin Conjugating Enzyme 1
           (NCUBE1) from [Gallus gallus] GI:7362937, [Mus musculus]
           GI:7363050, [Homo sapiens] GI:7362973; contains Pfam
           profile PF00179: Ubiquitin-conjugating enzyme
          Length = 309

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 18/46 (39%), Positives = 29/46 (63%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           A++ +  E K +Q  P + F + L  E+N+FEW+ AI GP DT ++
Sbjct: 12  AVKRILQEVKEMQANPSDDF-MSLPLEENIFEWQFAIRGPGDTEFE 56


>At5g59300.1 68418.m07430 ubiquitin-conjugating enzyme 7 (UBC7) E2;
           identical to gi:992703, SP:P42747
          Length = 198

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNVY +G +CISILHPP
Sbjct: 111 HPNVYSDGRVCISILHPP 128



 Score = 37.1 bits (82), Expect = 0.014
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +2

Query: 455 NLFEWEVAIFGPPDTLYQ 508
           N+FEW V I GPPDTLY+
Sbjct: 65  NIFEWSVTIIGPPDTLYE 82



 Score = 34.7 bits (76), Expect = 0.073
 Identities = 19/55 (34%), Positives = 26/55 (47%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWDDPQSGEL 675
           G+F A M FP +YP SPP++R  +      +Y    +        P DDP   EL
Sbjct: 84  GFFNAIMTFPQNYPNSPPTVRFTSDMWHPNVYSDGRV-CISILHPPGDDPSGYEL 137


>At5g25760.1 68418.m03057 ubiquitin-conjugating enzyme, putative
           similar to SP|O60015 Ubiquitin-conjugating enzyme E2-21
           kDa (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin
           carrier protein) {Pichia angusta}; contains Pfam profile
           PF00179: Ubiquitin-conjugating enzyme
          Length = 157

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = +2

Query: 392 EYKSLQEEPVEGFRVKLLGED-NLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHHHP 568
           EYK +Q E V    ++L+ +D N+F+W   I GP +T Y+    +   + P    +    
Sbjct: 11  EYKEVQREKVADPDIQLICDDTNIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQ 70

Query: 569 LGFLTKVW 592
           + FLTK++
Sbjct: 71  VRFLTKIF 78


>At5g50430.1 68418.m06245 ubiquitin-conjugating enzyme, putative
           similar to ubiquitin conjugating enzyme 6 from [Homo
           sapiens] GI:14029267, [Mus musculus] GI:14029263;
           contains Pfam profile PF00179: Ubiquitin-conjugating
           enzyme
          Length = 243

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSI 570
           G   + G++   +KFPP+YPY PP I
Sbjct: 46  GTPFAGGFYYGKIKFPPEYPYKPPGI 71


>At1g17280.1 68414.m02105 ubiquitin-conjugating enzyme, putative
           similar to ubiquitin conjugating enzyme 6 from [Homo
           sapiens] GI:14029267, [Mus musculus] GI:14029263;
           contains Pfam profile PF00179: Ubiquitin-conjugating
           enzyme
          Length = 237

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSI 570
           G   + G++   +KFPP+YPY PP I
Sbjct: 46  GTPFAGGFYYGKIKFPPEYPYKPPGI 71


>At5g62540.1 68418.m07849 ubiquitin-conjugating enzyme 3 (UBC3) E2;
           identical to gi:431261, SP:P42746
          Length = 150

 Score = 34.3 bits (75), Expect = 0.096
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT 529
           T+ A + L  ++K LQ++P  G       ++N+  W   IFGP DT +   T + T
Sbjct: 2   TTPAKKRLMWDFKRLQKDPPVGIS-GAPQDNNIMHWNALIFGPEDTPWDGGTFKLT 56


>At4g36410.1 68417.m05173 ubiquitin-conjugating enzyme 17 (UBC17)
           E2; identical to gi:2801446
          Length = 161

 Score = 34.3 bits (75), Expect = 0.096
 Identities = 18/52 (34%), Positives = 25/52 (48%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           T  A   L  E+   Q  P  GF+ ++   DNL  W + + G P TLY  +T
Sbjct: 13  TKIATNRLQKEFMEWQTNPPSGFKHRV--SDNLQRWIIEVHGVPGTLYANET 62



 Score = 27.9 bits (59), Expect = 8.3
 Identities = 7/16 (43%), Positives = 13/16 (81%)
 Frame = +3

Query: 594 HPNVYENGDLCISILH 641
           HP++Y NG +C+ +L+
Sbjct: 89  HPHIYSNGHICLDVLY 104


>At1g45050.1 68414.m05165 ubiquitin-conjugating enzyme 15 (UBC15)
           E2; identical to ubiquitin-conjugating enzyme 15
           GI:2801442 from [Arabidopsis thaliana]
          Length = 161

 Score = 34.3 bits (75), Expect = 0.096
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 5/62 (8%)
 Frame = +2

Query: 347 SNTVPTSSALRALALE--YKSLQE---EPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQV 511
           S++ P+  AL  +A     K L E    P  GFR K+   DNL +W + + G P TLY  
Sbjct: 3   SSSAPSRKALSKIACNRLQKELSEWQLNPPTGFRHKVT--DNLQKWTIDVTGAPGTLYAN 60

Query: 512 DT 517
           +T
Sbjct: 61  ET 62



 Score = 28.3 bits (60), Expect = 6.3
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = +3

Query: 594 HPNVYENGDLCISILH 641
           HP++Y NG +C+ IL+
Sbjct: 89  HPHIYSNGHICLDILY 104


>At2g16740.1 68415.m01920 ubiquitin-conjugating enzyme, putative
           strong similarity to SP|P35133 Ubiquitin-conjugating
           enzyme E2-17 kDa 10 (EC 6.3.2.19) (Ubiquitin- protein
           ligase 10) (Ubiquitin carrier protein 10) {Arabidopsis
           thaliana}; contains Pfam profile PF00179:
           Ubiquitin-conjugating enzyme
          Length = 148

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           S G F  ++ FPPDYP+ PP +
Sbjct: 46  SGGVFLVNIHFPPDYPFKPPKV 67



 Score = 31.9 bits (69), Expect = 0.51
 Identities = 16/45 (35%), Positives = 22/45 (48%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           A R +  E K LQ +P         GED +F W+  I GP ++ Y
Sbjct: 2   ATRRILKELKELQRDPPVSCSAGPTGED-MFHWQATIMGPNESPY 45


>At3g08690.1 68416.m01010 ubiquitin-conjugating enzyme 11 (UBC11)
           E2; identical to gi:12643427, SP:P35134
          Length = 148

 Score = 33.5 bits (73), Expect = 0.17
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           A + +  E K LQ++P        + ED +F W+  I GPP++ Y
Sbjct: 2   ASKRILKELKDLQKDPPSNCSAGPVAED-MFHWQATIMGPPESPY 45



 Score = 31.9 bits (69), Expect = 0.51
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F   + FPPDYP+ PP +
Sbjct: 46  AGGVFLVSIHFPPDYPFKPPKV 67


>At1g75440.1 68414.m08763 ubiquitin-conjugating enzyme 16 (UBC16)
           E2; identical to gi:2801444, GB:AAC39325 from
           [Arabidopsis thaliana] (Plant Mol. Biol. 23 (2), 387-396
           (1993))
          Length = 161

 Score = 33.5 bits (73), Expect = 0.17
 Identities = 19/49 (38%), Positives = 23/49 (46%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           A   L  E    Q  P  GF+ K+   DNL  W + + G P TLY  DT
Sbjct: 16  ATNRLQKELVEWQMNPPTGFKHKVT--DNLQRWIIEVIGAPGTLYANDT 62



 Score = 28.3 bits (60), Expect = 6.3
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = +3

Query: 594 HPNVYENGDLCISILH 641
           HP++Y NG +C+ IL+
Sbjct: 89  HPHIYSNGHICLDILY 104


>At5g41700.4 68418.m05071 ubiquitin-conjugating enzyme 8 (UBC8) E2;
           identical to gi:297882, SP:P35131
          Length = 149

 Score = 32.7 bits (71), Expect = 0.29
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           S G F   + FPPDYP+ PP +
Sbjct: 47  SGGVFLVTIHFPPDYPFKPPKV 68



 Score = 27.9 bits (59), Expect = 8.3
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = +3

Query: 525 THEIPP*LPVFTTIH*GF*LKSGHPNVYENGDLCISIL 638
           T   PP  P F      F  K  HPN+  NG +C+ IL
Sbjct: 54  TIHFPPDYP-FKPPKVAFRTKVFHPNINSNGSICLDIL 90


>At5g41700.3 68418.m05068 ubiquitin-conjugating enzyme 8 (UBC8) E2;
           identical to gi:297882, SP:P35131
          Length = 145

 Score = 32.7 bits (71), Expect = 0.29
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           S G F   + FPPDYP+ PP +
Sbjct: 46  SGGVFLVTIHFPPDYPFKPPKV 67



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 20/74 (27%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           A + +  E K LQ++P        + ED +F W+  I GP ++ Y       T + P   
Sbjct: 2   ASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATIMGPAESPYSGGVFLVTIHFPPDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TKV+
Sbjct: 61  PFKPPKVAFRTKVF 74



 Score = 27.9 bits (59), Expect = 8.3
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = +3

Query: 525 THEIPP*LPVFTTIH*GF*LKSGHPNVYENGDLCISIL 638
           T   PP  P F      F  K  HPN+  NG +C+ IL
Sbjct: 53  TIHFPPDYP-FKPPKVAFRTKVFHPNINSNGSICLDIL 89


>At5g41700.2 68418.m05070 ubiquitin-conjugating enzyme 8 (UBC8) E2;
           identical to gi:297882, SP:P35131
          Length = 148

 Score = 32.7 bits (71), Expect = 0.29
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           S G F   + FPPDYP+ PP +
Sbjct: 46  SGGVFLVTIHFPPDYPFKPPKV 67



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 20/74 (27%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           A + +  E K LQ++P        + ED +F W+  I GP ++ Y       T + P   
Sbjct: 2   ASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATIMGPAESPYSGGVFLVTIHFPPDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TKV+
Sbjct: 61  PFKPPKVAFRTKVF 74



 Score = 27.9 bits (59), Expect = 8.3
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = +3

Query: 525 THEIPP*LPVFTTIH*GF*LKSGHPNVYENGDLCISIL 638
           T   PP  P F      F  K  HPN+  NG +C+ IL
Sbjct: 53  TIHFPPDYP-FKPPKVAFRTKVFHPNINSNGSICLDIL 89


>At5g41700.1 68418.m05069 ubiquitin-conjugating enzyme 8 (UBC8) E2;
           identical to gi:297882, SP:P35131
          Length = 148

 Score = 32.7 bits (71), Expect = 0.29
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           S G F   + FPPDYP+ PP +
Sbjct: 46  SGGVFLVTIHFPPDYPFKPPKV 67



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 20/74 (27%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           A + +  E K LQ++P        + ED +F W+  I GP ++ Y       T + P   
Sbjct: 2   ASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATIMGPAESPYSGGVFLVTIHFPPDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TKV+
Sbjct: 61  PFKPPKVAFRTKVF 74



 Score = 27.9 bits (59), Expect = 8.3
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = +3

Query: 525 THEIPP*LPVFTTIH*GF*LKSGHPNVYENGDLCISIL 638
           T   PP  P F      F  K  HPN+  NG +C+ IL
Sbjct: 53  TIHFPPDYP-FKPPKVAFRTKVFHPNINSNGSICLDIL 89


>At4g27960.2 68417.m04012 ubiquitin-conjugating enzyme E2-17 kDa 9
           (UBC9) E2; identical to gi:297883, SP:P35132; identical
           to cDNA UBC9 for ubiquitin conjugating enzyme homolog
           GI:297883
          Length = 178

 Score = 32.7 bits (71), Expect = 0.29
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           S G F   + FPPDYP+ PP +
Sbjct: 76  SGGVFLVTIHFPPDYPFKPPKV 97



 Score = 32.3 bits (70), Expect = 0.39
 Identities = 21/74 (28%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           A + +  E K LQ++P        + ED +F W+  I GP D+ Y       T + P   
Sbjct: 32  ASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATIMGPSDSPYSGGVFLVTIHFPPDY 90

Query: 551 RIHHHPLGFLTKVW 592
                 + F TKV+
Sbjct: 91  PFKPPKVAFRTKVF 104



 Score = 27.9 bits (59), Expect = 8.3
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = +3

Query: 525 THEIPP*LPVFTTIH*GF*LKSGHPNVYENGDLCISIL 638
           T   PP  P F      F  K  HPN+  NG +C+ IL
Sbjct: 83  TIHFPPDYP-FKPPKVAFRTKVFHPNINSNGSICLDIL 119


>At4g27960.1 68417.m04011 ubiquitin-conjugating enzyme E2-17 kDa 9
           (UBC9) E2; identical to gi:297883, SP:P35132; identical
           to cDNA UBC9 for ubiquitin conjugating enzyme homolog
           GI:297883
          Length = 148

 Score = 32.7 bits (71), Expect = 0.29
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           S G F   + FPPDYP+ PP +
Sbjct: 46  SGGVFLVTIHFPPDYPFKPPKV 67



 Score = 32.3 bits (70), Expect = 0.39
 Identities = 21/74 (28%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           A + +  E K LQ++P        + ED +F W+  I GP D+ Y       T + P   
Sbjct: 2   ASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATIMGPSDSPYSGGVFLVTIHFPPDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TKV+
Sbjct: 61  PFKPPKVAFRTKVF 74



 Score = 27.9 bits (59), Expect = 8.3
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = +3

Query: 525 THEIPP*LPVFTTIH*GF*LKSGHPNVYENGDLCISIL 638
           T   PP  P F      F  K  HPN+  NG +C+ IL
Sbjct: 53  TIHFPPDYP-FKPPKVAFRTKVFHPNINSNGSICLDIL 89


>At1g64230.1 68414.m07276 ubiquitin-conjugating enzyme, putative
           identical or nearly so to Ubiquitin-conjugating enzymes
           SP|P35132, SP|P35131, SP|P35133 from {Arabidopsis
           thaliana}; contains Pfam profile PF00179:
           Ubiquitin-conjugating enzyme
          Length = 148

 Score = 32.7 bits (71), Expect = 0.29
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           S G F   + FPPDYP+ PP +
Sbjct: 46  SGGVFLVTIHFPPDYPFKPPKV 67



 Score = 32.3 bits (70), Expect = 0.39
 Identities = 21/74 (28%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           A + +  E K LQ++P        + ED +F W+  I GP D+ Y       T + P   
Sbjct: 2   ASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATIMGPSDSPYSGGVFLVTIHFPPDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TKV+
Sbjct: 61  PFKPPKVAFRTKVF 74



 Score = 28.3 bits (60), Expect = 6.3
 Identities = 16/38 (42%), Positives = 18/38 (47%)
 Frame = +3

Query: 525 THEIPP*LPVFTTIH*GF*LKSGHPNVYENGDLCISIL 638
           T   PP  P F      F  K  HPNV  NG +C+ IL
Sbjct: 53  TIHFPPDYP-FKPPKVAFRTKVFHPNVNSNGSICLDIL 89


>At3g08700.1 68416.m01011 ubiquitin-conjugating enzyme, putative
           strong similar to ubiquitin-conjugating enzymes E2-17
           from [Arabidopsis thaliana] SP|P35134, SP|P35132,
           SP|P35133; contains Pfam profile PF00179:
           Ubiquitin-conjugating enzyme
          Length = 149

 Score = 31.9 bits (69), Expect = 0.51
 Identities = 12/45 (26%), Positives = 23/45 (51%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           A + ++ E + +Q  P        + E+++F W+  I GP D+ Y
Sbjct: 2   ASKRISRELRDMQRHPPANCSAGPVAEEDIFHWQATIMGPHDSPY 46


>At2g02760.1 68415.m00219 ubiquitin-conjugating enzyme 2 (UBC2) E2;
           identical to gi:2689242, SP:P42745
          Length = 152

 Score = 31.9 bits (69), Expect = 0.51
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           ++ A + L  ++K LQ++P  G       ++N+  W   IFGP DT
Sbjct: 2   STPARKRLMRDFKRLQQDPPAGIS-GAPQDNNIMLWNAVIFGPDDT 46



 Score = 28.7 bits (61), Expect = 4.8
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIR 573
           G FK  ++F  DYP  PP++R
Sbjct: 51  GTFKLSLQFSEDYPNKPPTVR 71


>At1g14400.2 68414.m01708 ubiquitin-conjugating enzyme 1 (UBC1) E2;
           identical to gi:431259, SP:P25865
          Length = 152

 Score = 31.9 bits (69), Expect = 0.51
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           ++ A + L  ++K LQ++P  G       ++N+  W   IFGP DT
Sbjct: 2   STPARKRLMRDFKRLQQDPPAGIS-GAPQDNNIMLWNAVIFGPDDT 46



 Score = 28.7 bits (61), Expect = 4.8
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIR 573
           G FK  ++F  DYP  PP++R
Sbjct: 51  GTFKLSLQFSEDYPNKPPTVR 71


>At1g14400.1 68414.m01707 ubiquitin-conjugating enzyme 1 (UBC1) E2;
           identical to gi:431259, SP:P25865
          Length = 152

 Score = 31.9 bits (69), Expect = 0.51
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           ++ A + L  ++K LQ++P  G       ++N+  W   IFGP DT
Sbjct: 2   STPARKRLMRDFKRLQQDPPAGIS-GAPQDNNIMLWNAVIFGPDDT 46



 Score = 28.7 bits (61), Expect = 4.8
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIR 573
           G FK  ++F  DYP  PP++R
Sbjct: 51  GTFKLSLQFSEDYPNKPPTVR 71


>At5g56150.2 68418.m07005 ubiquitin-conjugating enzyme, putative
           strong similarity to ubiquitin-conjugating enzyme UBC2
           [Mesembryanthemum crystallinum] GI:5762457, UBC4 [Pisum
           sativum] GI:456568; contains Pfam profile PF00179:
           Ubiquitin-conjugating enzyme
          Length = 148

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F   + FPPDYP+ PP +
Sbjct: 46  AGGVFLVTIHFPPDYPFKPPKV 67



 Score = 29.5 bits (63), Expect = 2.7
 Identities = 19/74 (25%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           A + +  E + LQ +P         G+D +F+W+  I GP D+ +       T + P   
Sbjct: 2   ASKRINKELRDLQRDPPVSCSAGPTGDD-MFQWQATIMGPADSPFAGGVFLVTIHFPPDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TKV+
Sbjct: 61  PFKPPKVAFRTKVY 74



 Score = 27.9 bits (59), Expect = 8.3
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = +3

Query: 525 THEIPP*LPVFTTIH*GF*LKSGHPNVYENGDLCISIL 638
           T   PP  P F      F  K  HPN+  NG +C+ IL
Sbjct: 53  TIHFPPDYP-FKPPKVAFRTKVYHPNINSNGSICLDIL 89


>At5g56150.1 68418.m07004 ubiquitin-conjugating enzyme, putative
           strong similarity to ubiquitin-conjugating enzyme UBC2
           [Mesembryanthemum crystallinum] GI:5762457, UBC4 [Pisum
           sativum] GI:456568; contains Pfam profile PF00179:
           Ubiquitin-conjugating enzyme
          Length = 148

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F   + FPPDYP+ PP +
Sbjct: 46  AGGVFLVTIHFPPDYPFKPPKV 67



 Score = 29.5 bits (63), Expect = 2.7
 Identities = 19/74 (25%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           A + +  E + LQ +P         G+D +F+W+  I GP D+ +       T + P   
Sbjct: 2   ASKRINKELRDLQRDPPVSCSAGPTGDD-MFQWQATIMGPADSPFAGGVFLVTIHFPPDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TKV+
Sbjct: 61  PFKPPKVAFRTKVY 74



 Score = 27.9 bits (59), Expect = 8.3
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = +3

Query: 525 THEIPP*LPVFTTIH*GF*LKSGHPNVYENGDLCISIL 638
           T   PP  P F      F  K  HPN+  NG +C+ IL
Sbjct: 53  TIHFPPDYP-FKPPKVAFRTKVYHPNINSNGSICLDIL 89


>At5g53300.2 68418.m06625 ubiquitin-conjugating enzyme 10 (UBC10)
           E2; identical to gi:297877, SP:P35133
          Length = 148

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F   + FPPDYP+ PP +
Sbjct: 46  AGGVFLVTIHFPPDYPFKPPKV 67



 Score = 30.3 bits (65), Expect = 1.6
 Identities = 20/74 (27%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           A + +  E K LQ++P        + ED +F W+  I GP ++ Y       T + P   
Sbjct: 2   ASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATIMGPSESPYAGGVFLVTIHFPPDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TKV+
Sbjct: 61  PFKPPKVAFRTKVF 74



 Score = 27.9 bits (59), Expect = 8.3
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = +3

Query: 525 THEIPP*LPVFTTIH*GF*LKSGHPNVYENGDLCISIL 638
           T   PP  P F      F  K  HPN+  NG +C+ IL
Sbjct: 53  TIHFPPDYP-FKPPKVAFRTKVFHPNINSNGSICLDIL 89


>At5g53300.1 68418.m06624 ubiquitin-conjugating enzyme 10 (UBC10)
           E2; identical to gi:297877, SP:P35133
          Length = 148

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F   + FPPDYP+ PP +
Sbjct: 46  AGGVFLVTIHFPPDYPFKPPKV 67



 Score = 30.3 bits (65), Expect = 1.6
 Identities = 20/74 (27%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           A + +  E K LQ++P        + ED +F W+  I GP ++ Y       T + P   
Sbjct: 2   ASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATIMGPSESPYAGGVFLVTIHFPPDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TKV+
Sbjct: 61  PFKPPKVAFRTKVF 74



 Score = 27.9 bits (59), Expect = 8.3
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = +3

Query: 525 THEIPP*LPVFTTIH*GF*LKSGHPNVYENGDLCISIL 638
           T   PP  P F      F  K  HPN+  NG +C+ IL
Sbjct: 53  TIHFPPDYP-FKPPKVAFRTKVFHPNINSNGSICLDIL 89


>At5g42990.1 68418.m05243 ubiquitin-conjugating enzyme 18 (UBC18)
           E2; identical to gi:2801448
          Length = 161

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 17/49 (34%), Positives = 24/49 (48%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           A   L  E    Q  P  GF+ ++   DNL +W + + G P TLY  +T
Sbjct: 16  ACNRLQKELSEWQVNPPTGFKHRVT--DNLQKWVIEVTGAPGTLYANET 62



 Score = 28.3 bits (60), Expect = 6.3
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = +3

Query: 594 HPNVYENGDLCISILH 641
           HP++Y NG +C+ IL+
Sbjct: 89  HPHIYSNGHICLDILY 104


>At3g57870.1 68416.m06451 ubiquitin-conjugating enzyme, putative
           strong similarity to SP|P50550 Ubiquitin-like protein
           SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO- 1-protein
           ligase) (Ubiquitin carrier protein)
           (Ubiquitin-conjugating enzyme UbcE2A) {Xenopus laevis};
           contains Pfam profile PF00179: Ubiquitin-conjugating
           enzyme
          Length = 160

 Score = 31.1 bits (67), Expect = 0.90
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTA 677
           HPNVY +G +C+SIL+   G    WR A
Sbjct: 84  HPNVYPSGTVCLSILNEDYG----WRPA 107


>At1g36340.1 68414.m04516 ubiquitin-conjugating enzyme family
           protein similar to  Ubiquitin-conjugating enzyme E2-16
           kDa (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin
           carrier protein) from {Schizosaccharomyces pombe}
           SP|P46595, {Caenorhabditis elegans} SP|P35129; contains
           Pfam profile PF00179: Ubiquitin-conjugating enzyme
          Length = 154

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 11/24 (45%), Positives = 13/24 (54%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPP 564
           G     G F   +KFP DYP+ PP
Sbjct: 48  GTPYEGGMFNLSIKFPTDYPFKPP 71


>At2g32790.1 68415.m04014 ubiquitin-conjugating enzyme, putative
           similar to ubiquitin conjugating enzyme from [Oryza
           sativa] GI:1373001, {Arabidopsis thaliana} SP|P35134,
           SP|P35131; contains Pfam profile PF00179:
           Ubiquitin-conjugating enzyme
          Length = 177

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 11/26 (42%), Positives = 12/26 (46%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSI 570
           G     G F   +  PP YPY PP I
Sbjct: 71  GCPYEKGVFTVSVHIPPKYPYEPPKI 96


>At1g55535.2 68414.m06355 expressed protein
          Length = 250

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +3

Query: 636 LHPPVG*SSVWRTAPANVGNPTQSVRNRYSPSGNLNPS-KEPEHLSVPGERSMPTV 800
           ++ P   +S++  +  N+ +P  +  N YS   N +PS  E  H+  P  RS+ ++
Sbjct: 183 IYDPAYYTSLFEESQTNINSPKATQVNHYSAGNNGSPSAAEASHIKSPIFRSLHSI 238


>At1g55535.1 68414.m06354 expressed protein
          Length = 260

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +3

Query: 636 LHPPVG*SSVWRTAPANVGNPTQSVRNRYSPSGNLNPS-KEPEHLSVPGERSMPTV 800
           ++ P   +S++  +  N+ +P  +  N YS   N +PS  E  H+  P  RS+ ++
Sbjct: 183 IYDPAYYTSLFEESQTNINSPKATQVNHYSAGNNGSPSAAEASHIKSPIFRSLHSI 238


>At5g05080.1 68418.m00539 ubiquitin-conjugating enzyme, putative
           similar to SP|Q16763 Ubiquitin-conjugating enzyme E2-24
           kDa (EC 6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin
           carrier protein) {Homo sapiens}; contains Pfam profile
           PF00179: Ubiquitin-conjugating enzyme
          Length = 251

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 17/54 (31%), Positives = 29/54 (53%)
 Frame = +2

Query: 347 SNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           SN     + ++ LA E KSL E P +G +V ++ +++  +    I GP  T Y+
Sbjct: 3   SNENLPPNVIKQLAKELKSLDESPPDGIKV-VVNDEDFSQICADIEGPVGTPYE 55


>At4g10020.1 68417.m01639 short-chain dehydrogenase/reductase (SDR)
           family protein similar to sterol-binding dehydrogenase
           steroleosin GI:15824408 from [Sesamum indicum]
          Length = 389

 Score = 24.2 bits (50), Expect(2) = 5.6
 Identities = 9/15 (60%), Positives = 9/15 (60%)
 Frame = +1

Query: 538 PPDYPYSPPSIRVFN 582
           PP YP SPP    FN
Sbjct: 371 PPRYPASPPRFSQFN 385



 Score = 22.6 bits (46), Expect(2) = 5.6
 Identities = 11/23 (47%), Positives = 13/23 (56%)
 Frame = +1

Query: 496 YTLSSGYFKAHMKFPPDYPYSPP 564
           YT S  ++ A    PP YP SPP
Sbjct: 353 YTASPPHYTAS---PPRYPASPP 372


>At3g20060.1 68416.m02537 ubiquitin-conjugating enzyme 19 (UBC19)
           nearly identical to ubiquitin-conjugating enzyme UBC19
           [Arabidopsis thaliana] GI:22530865; contains Pfam
           profile PF00179: Ubiquitin-conjugating enzyme
          Length = 181

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 17/54 (31%), Positives = 25/54 (46%)
 Frame = +2

Query: 347 SNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           + TV + S L+ L  E   L      G       EDN+F W+  I G  DT+++
Sbjct: 29  TKTVDSHSVLKRLQSELMGLMMGADPGISA-FPEEDNIFCWKGTITGSKDTVFE 81


>At2g33770.1 68415.m04141 ubiquitin-conjugating enzyme family
           protein low similarity to ubiquitin-conjugating
           BIR-domain enzyme APOLLON [Homo sapiens] GI:8489831,
           ubiquitin-conjugating enzyme [Mus musculus] GI:3319990;
           contains Pfam profile PF00179: Ubiquitin-conjugating
           enzyme
          Length = 907

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 11/33 (33%), Positives = 22/33 (66%), Gaps = 1/33 (3%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG-*SSVWRTAPANV 689
           +PN+YE+G +C+S+L+   G  + VW    +++
Sbjct: 738 NPNLYESGRVCLSLLNTWSGSGTEVWNAGSSSI 770


>At1g50490.1 68414.m05662 ubiquitin-conjugating enzyme 20 (UBC20)
           nearly identical to ubiquitin-conjugating enzyme UBC20
           [Arabidopsis thaliana] GI:22530867; contains Pfam
           profile PF00179: Ubiquitin-conjugating enzyme
          Length = 180

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 17/54 (31%), Positives = 25/54 (46%)
 Frame = +2

Query: 347 SNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           + TV + S L+ L  E   L      G       EDN+F W+  I G  DT+++
Sbjct: 28  TKTVDSQSVLKRLQSELMGLMMGGGPGISA-FPEEDNIFCWKGTITGSKDTVFE 80


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,530,176
Number of Sequences: 28952
Number of extensions: 449906
Number of successful extensions: 1208
Number of sequences better than 10.0: 39
Number of HSP's better than 10.0 without gapping: 1082
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1208
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1824072800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).