SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30049
         (727 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g13920.1 68416.m01758 eukaryotic translation initiation facto...    98   6e-21
At1g72730.1 68414.m08410 eukaryotic translation initiation facto...    96   2e-20
At1g54270.1 68414.m06187 eukaryotic translation initiation facto...    95   6e-20
At3g19760.1 68416.m02501 eukaryotic translation initiation facto...    94   1e-19
At1g51380.1 68414.m05780 eukaryotic translation initiation facto...    82   4e-16
At4g00660.2 68417.m00091 DEAD/DEAH box helicase, putative simila...    61   8e-10
At4g00660.1 68417.m00090 DEAD/DEAH box helicase, putative simila...    61   8e-10
At2g45810.1 68415.m05697 DEAD/DEAH box helicase, putative              61   8e-10
At3g61240.2 68416.m06854 DEAD/DEAH box helicase, putative (RH12)...    60   2e-09
At3g61240.1 68416.m06853 DEAD/DEAH box helicase, putative (RH12)...    60   2e-09
At4g34910.1 68417.m04950 DEAD/DEAH box helicase, putative (RH16)...    55   6e-08
At5g60990.1 68418.m07651 DEAD/DEAH box helicase, putative (RH10)...    52   5e-07
At5g11200.1 68418.m01309 DEAD/DEAH box helicase, putative              52   5e-07
At5g11170.1 68418.m01305 DEAD/DEAH box helicase, putative (RH15)...    52   5e-07
At2g47330.1 68415.m05908 DEAD/DEAH box helicase, putative simila...    48   6e-06
At3g06980.1 68416.m00829 DEAD/DEAH box helicase, putative contai...    48   8e-06
At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative simila...    46   3e-05
At3g18600.1 68416.m02364 DEAD/DEAH box helicase, putative non-co...    46   3e-05
At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contai...    45   4e-05
At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28)...    45   4e-05
At2g33730.1 68415.m04134 DEAD box RNA helicase, putative similar...    45   6e-05
At5g11170.2 68418.m01306 DEAD/DEAH box helicase, putative (RH15)...    44   8e-05
At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s...    44   8e-05
At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar...    44   1e-04
At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helica...    44   1e-04
At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helica...    44   1e-04
At3g01540.3 68416.m00084 DEAD box RNA helicase (DRH1) identical ...    44   1e-04
At3g01540.2 68416.m00083 DEAD box RNA helicase (DRH1) identical ...    44   1e-04
At3g01540.1 68416.m00082 DEAD box RNA helicase (DRH1) identical ...    44   1e-04
At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar...    43   2e-04
At5g08620.1 68418.m01025 DEAD box RNA helicase (RH25) identical ...    42   3e-04
At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong sim...    42   3e-04
At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA...    42   3e-04
At3g53110.1 68416.m05853 DEAD/DEAH box helicase, putative RNA he...    42   3e-04
At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar...    42   3e-04
At1g77050.1 68414.m08971 DEAD/DEAH box helicase, putative simila...    42   3e-04
At1g12770.1 68414.m01482 DEAD/DEAH box helicase family protein /...    42   3e-04
At5g26742.1 68418.m03161 DEAD box RNA helicase (RH3) nearly iden...    40   0.001
At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar...    40   0.001
At1g55150.1 68414.m06298 DEAD box RNA helicase, putative (RH20) ...    40   0.002
At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13)...    39   0.003
At2g40700.1 68415.m05021 DEAD/DEAH box helicase, putative (RH17)...    39   0.003
At2g07750.1 68415.m01003 DEAD box RNA helicase, putative similar...    39   0.004
At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar...    38   0.005
At1g63250.1 68414.m07150 DEAD box RNA helicase, putative similar...    38   0.005
At5g63630.1 68418.m07989 DEAD box RNA helicase, putative strong ...    38   0.007
At5g19210.2 68418.m02287 DEAD/DEAH box helicase, putative EUKARY...    38   0.009
At1g31970.1 68414.m03931 DEAD/DEAH box helicase, putative simila...    38   0.009
At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ...    37   0.012
At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ...    37   0.012
At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar...    37   0.012
At5g51280.1 68418.m06357 DEAD-box protein abstrakt, putative           36   0.021
At3g09720.1 68416.m01151 DEAD/DEAH box helicase, putative simila...    36   0.021
At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative simila...    36   0.021
At1g59990.1 68414.m06758 DEAD/DEAH box helicase, putative (RH22)...    34   0.083
At4g09730.1 68417.m01598 DEAD/DEAH box helicase, putative RNA he...    34   0.11 
At3g02065.2 68416.m00170 DEAD/DEAH box helicase family protein c...    32   0.34 
At3g02065.1 68416.m00171 DEAD/DEAH box helicase family protein c...    32   0.34 
At5g54910.1 68418.m06839 DEAD/DEAH box helicase, putative              32   0.45 
At1g71370.1 68414.m08239 DEAD/DEAH box helicase, putative simila...    32   0.45 
At1g71280.1 68414.m08226 DEAD/DEAH box helicase, putative contai...    31   0.59 
At3g49970.1 68416.m05464 phototropic-responsive protein, putativ...    30   1.4  
At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi...    30   1.4  
At5g05450.1 68418.m00587 DEAD/DEAH box helicase, putative (RH18)       29   2.4  
At4g14365.1 68417.m02213 zinc finger (C3HC4-type RING finger) fa...    29   3.1  
At2g04620.1 68415.m00470 cation efflux family protein potential ...    29   3.1  
At4g24430.1 68417.m03502 expressed protein                             29   4.1  
At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containi...    29   4.1  
At5g18910.1 68418.m02246 protein kinase family protein contains ...    28   5.5  
At3g10810.1 68416.m01301 zinc finger (C3HC4-type RING finger) fa...    28   5.5  
At3g53720.1 68416.m05934 cation/hydrogen exchanger, putative (CH...    28   7.2  
At1g01950.1 68414.m00113 armadillo/beta-catenin repeat family pr...    28   7.2  
At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id...    27   9.6  
At4g26510.2 68417.m03818 uracil phosphoribosyltransferase / UMP ...    27   9.6  
At4g26510.1 68417.m03817 uracil phosphoribosyltransferase / UMP ...    27   9.6  
At1g76010.1 68414.m08825 expressed protein                             27   9.6  

>At3g13920.1 68416.m01758 eukaryotic translation initiation factor
           4A-1 / eIF-4A-1 eIF-4A-1 gi:15293046, gi:15450485;
           contains Pfam profile PF00270: DEAD/DEAH box helicase;
           contains Pfam profile PF00271: Helicase conserved
           C-terminal domain
          Length = 412

 Score = 97.9 bits (233), Expect = 6e-21
 Identities = 45/67 (67%), Positives = 56/67 (83%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATF   +LQQ+D S+ +CQAL+LAPTRELAQQI+KV+ ALGD+L  K HAC+GGT+VR
Sbjct: 89  KTATFCSGVLQQLDFSLIQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVR 148

Query: 434 EDIRQLE 454
           ED R L+
Sbjct: 149 EDQRILQ 155



 Score = 88.2 bits (209), Expect = 5e-18
 Identities = 42/58 (72%), Positives = 47/58 (81%)
 Frame = +3

Query: 84  TDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           T +D V E+FD M L+E LLRGIYAYGFEKPSAIQQR I+P  +G DVI QAQSGTGK
Sbjct: 32  TSYDDVHESFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGK 89



 Score = 35.5 bits (78), Expect = 0.036
 Identities = 16/27 (59%), Positives = 20/27 (74%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+      A+ IK+FVLDEADE
Sbjct: 166 GRVFDMLKRQSLRADNIKMFVLDEADE 192


>At1g72730.1 68414.m08410 eukaryotic translation initiation factor
           4A, putative / eIF-4A, putative similar to Eukaryotic
           initiation factor 4A-10 GB:P41382 [Nicotiana tabacum];
           identical to (putative) RNA helicase GB:CAA09211
           [Arabidopsis thaliana] (Nucleic Acids Res. 27 (2),
           628-636 (1999))
          Length = 414

 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 44/67 (65%), Positives = 55/67 (82%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATF   +LQQ+D S+ +CQAL+LAPTRELAQQI+KV+ ALGD+L  K  AC+GGT+VR
Sbjct: 91  KTATFCSGVLQQLDISLVQCQALVLAPTRELAQQIEKVMRALGDYLGVKAQACVGGTSVR 150

Query: 434 EDIRQLE 454
           ED R L+
Sbjct: 151 EDQRVLQ 157



 Score = 88.2 bits (209), Expect = 5e-18
 Identities = 40/59 (67%), Positives = 50/59 (84%)
 Frame = +3

Query: 81  HTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +T++D+V ++FD M L+ +LLRGIYAYGFEKPSAIQQR I+P  +G DVI QAQSGTGK
Sbjct: 33  YTNYDEVCDSFDAMELQPDLLRGIYAYGFEKPSAIQQRGIIPFCKGLDVIQQAQSGTGK 91



 Score = 34.3 bits (75), Expect = 0.083
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+D++      A+ IK+FVLDEADE
Sbjct: 168 GRVFDLLRRQSLRADAIKMFVLDEADE 194


>At1g54270.1 68414.m06187 eukaryotic translation initiation factor
           4A-2 / eIF-4A-2 similar to eukaryotic translation
           initiation factor 4A GI:19696 from [Nicotiana
           plumbaginifolia]
          Length = 412

 Score = 94.7 bits (225), Expect = 6e-20
 Identities = 43/67 (64%), Positives = 55/67 (82%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATF   +LQQ+D ++ +CQAL+LAPTRELAQQI+KV+ ALGD+   K HAC+GGT+VR
Sbjct: 89  KTATFCSGVLQQLDYALLQCQALVLAPTRELAQQIEKVMRALGDYQGVKVHACVGGTSVR 148

Query: 434 EDIRQLE 454
           ED R L+
Sbjct: 149 EDQRILQ 155



 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 42/58 (72%), Positives = 48/58 (82%)
 Frame = +3

Query: 84  TDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           T +D+V E+FD M L+E LLRGIYAYGFEKPSAIQQR I+P  +G DVI QAQSGTGK
Sbjct: 32  TSYDEVHESFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGK 89



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+       + IK+FVLDEADE
Sbjct: 166 GRVFDMLRRQSLRPDCIKMFVLDEADE 192


>At3g19760.1 68416.m02501 eukaryotic translation initiation factor
           4A, putative / eIF-4A, putative / DEAD box RNA helicase,
           putative contains DEAD/DEAH helicase domain; similar to
           RNA helicase GB:CAA09195 from [Arabidopsis thaliana];
           identical to cDNA DEAD box RNA helicase, RH2 GI:3775984
          Length = 408

 Score = 93.9 bits (223), Expect = 1e-19
 Identities = 41/58 (70%), Positives = 51/58 (87%)
 Frame = +3

Query: 84  TDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           TD  + + +F+DM +KE++LRG+Y YGFEKPSAIQQRA+MP +QGRDVIAQAQSGTGK
Sbjct: 28  TDGIEPITSFNDMGIKEDVLRGVYEYGFEKPSAIQQRAVMPILQGRDVIAQAQSGTGK 85



 Score = 84.6 bits (200), Expect = 6e-17
 Identities = 39/67 (58%), Positives = 51/67 (76%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT+  ++S+ Q +DTS RE QALIL+PTRELA Q +K + A+G H N + HACIGG +V 
Sbjct: 85  KTSMIALSVCQVVDTSSREVQALILSPTRELATQTEKTIQAIGLHANIQAHACIGGNSVG 144

Query: 434 EDIRQLE 454
           EDIR+LE
Sbjct: 145 EDIRKLE 151



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 14/27 (51%), Positives = 16/27 (59%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV DMI         IKL +LDE+DE
Sbjct: 162 GRVCDMIKRRSLRTRAIKLLILDESDE 188


>At1g51380.1 68414.m05780 eukaryotic translation initiation factor
           4A, putative / eIF-4A, putative
          Length = 392

 Score = 81.8 bits (193), Expect = 4e-16
 Identities = 33/52 (63%), Positives = 47/52 (90%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +++FDDM + +++LRG+Y YG++KPS IQQRA++P ++GRDVIAQAQSGTGK
Sbjct: 21  IKSFDDMGMNDKVLRGVYDYGYKKPSEIQQRALVPILKGRDVIAQAQSGTGK 72



 Score = 74.5 bits (175), Expect = 6e-14
 Identities = 32/67 (47%), Positives = 49/67 (73%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT+  +IS+ Q ++ S R+ Q L+L+P+RELA Q +K + A+G H N + HACIGG ++ 
Sbjct: 72  KTSMIAISVCQIVNISSRKVQVLVLSPSRELASQTEKTIQAIGAHTNIQAHACIGGKSIG 131

Query: 434 EDIRQLE 454
           EDI++LE
Sbjct: 132 EDIKKLE 138



 Score = 32.3 bits (70), Expect = 0.34
 Identities = 15/27 (55%), Positives = 17/27 (62%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRVYDMI         +KL VLDE+DE
Sbjct: 149 GRVYDMIKRGSLQTKAVKLLVLDESDE 175


>At4g00660.2 68417.m00091 DEAD/DEAH box helicase, putative similar
           to ATP-dependent RNA helicases
          Length = 505

 Score = 60.9 bits (141), Expect = 8e-10
 Identities = 27/49 (55%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK ELL GIY  GFE+PS IQ+ +I   + GRD++A+A++GTGK
Sbjct: 133 FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGK 181



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 29/66 (43%), Positives = 41/66 (62%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F I +L++ID      QA+I+ PTRELA Q  +V   LG HL  +     GGT+++
Sbjct: 181 KTAAFCIPVLEKIDQDNNVIQAVIIVPTRELALQTSQVCKELGKHLKIQVMVTTGGTSLK 240

Query: 434 EDIRQL 451
           +DI +L
Sbjct: 241 DDIMRL 246


>At4g00660.1 68417.m00090 DEAD/DEAH box helicase, putative similar
           to ATP-dependent RNA helicases
          Length = 505

 Score = 60.9 bits (141), Expect = 8e-10
 Identities = 27/49 (55%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK ELL GIY  GFE+PS IQ+ +I   + GRD++A+A++GTGK
Sbjct: 133 FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGK 181



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 29/66 (43%), Positives = 41/66 (62%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F I +L++ID      QA+I+ PTRELA Q  +V   LG HL  +     GGT+++
Sbjct: 181 KTAAFCIPVLEKIDQDNNVIQAVIIVPTRELALQTSQVCKELGKHLKIQVMVTTGGTSLK 240

Query: 434 EDIRQL 451
           +DI +L
Sbjct: 241 DDIMRL 246


>At2g45810.1 68415.m05697 DEAD/DEAH box helicase, putative
          Length = 528

 Score = 60.9 bits (141), Expect = 8e-10
 Identities = 27/49 (55%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK +LLRGIY  GFEKPS IQ+ +I   + G D++A+A++GTGK
Sbjct: 156 FEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGK 204



 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 28/66 (42%), Positives = 38/66 (57%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  F I  L++ID      QA+IL PTRELA Q  +V   L  +L  +     GGT++R
Sbjct: 204 KTGAFCIPTLEKIDPENNVIQAVILVPTRELALQTSQVCKELSKYLKIEVMVTTGGTSLR 263

Query: 434 EDIRQL 451
           +DI +L
Sbjct: 264 DDIMRL 269


>At3g61240.2 68416.m06854 DEAD/DEAH box helicase, putative (RH12)
           identical to cDNA DEAD box RNA helicase, RH12 GI:3776000
          Length = 498

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 26/49 (53%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK +LL+GIY  GFEKPS IQ+ +I   + G D++A+A++GTGK
Sbjct: 126 FEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGK 174



 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 29/66 (43%), Positives = 41/66 (62%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  F I +L++ID +    QA+IL PTRELA Q  +V   L  +LN +     GGT++R
Sbjct: 174 KTGAFCIPVLEKIDPNNNVIQAMILVPTRELALQTSQVCKELSKYLNIQVMVTTGGTSLR 233

Query: 434 EDIRQL 451
           +DI +L
Sbjct: 234 DDIMRL 239


>At3g61240.1 68416.m06853 DEAD/DEAH box helicase, putative (RH12)
           identical to cDNA DEAD box RNA helicase, RH12 GI:3776000
          Length = 498

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 26/49 (53%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK +LL+GIY  GFEKPS IQ+ +I   + G D++A+A++GTGK
Sbjct: 126 FEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGK 174



 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 29/66 (43%), Positives = 41/66 (62%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KT  F I +L++ID +    QA+IL PTRELA Q  +V   L  +LN +     GGT++R
Sbjct: 174 KTGAFCIPVLEKIDPNNNVIQAMILVPTRELALQTSQVCKELSKYLNIQVMVTTGGTSLR 233

Query: 434 EDIRQL 451
           +DI +L
Sbjct: 234 DDIMRL 239


>At4g34910.1 68417.m04950 DEAD/DEAH box helicase, putative (RH16)
           identical to cDNA DEAD box RNA helicase, RH16 GI:3776006
          Length = 626

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 25/70 (35%), Positives = 43/70 (61%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           ++  ++F+++ L   L+R +   G EKP+ IQQ AI   ++G+DV+A+A++G+GK L  L
Sbjct: 42  EEAPKSFEELGLDSRLIRALTKKGIEKPTLIQQSAIPYILEGKDVVARAKTGSGKTLAYL 101

Query: 273 YRFYNKSIQA 302
                K   A
Sbjct: 102 LPLLQKLFSA 111


>At5g60990.1 68418.m07651 DEAD/DEAH box helicase, putative (RH10)
           probable replication protein A1, Oryza sativa,
           EMBL:AF009179
          Length = 456

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 22/55 (40%), Positives = 39/55 (70%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++VV+TF ++ ++EEL++     G++ PS IQ  A+   ++G+DVI  AQ+G+GK
Sbjct: 5   NEVVKTFAELGVREELVKACERLGWKNPSKIQAEALPFALEGKDVIGLAQTGSGK 59



 Score = 35.1 bits (77), Expect = 0.048
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           A +L+PTRELA QI +   ALG  ++ +C   +GG
Sbjct: 92  ACVLSPTRELAIQIAEQFEALGADISLRCAVLVGG 126


>At5g11200.1 68418.m01309 DEAD/DEAH box helicase, putative
          Length = 427

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 27/49 (55%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DVI QA+SG GK
Sbjct: 48  FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGK 96



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 1/61 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F +S LQQI+ S  +  AL+L  TRELA QI    +    +L + K     GG N+
Sbjct: 96  KTAVFVLSTLQQIEPSPGQVSALVLCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNI 155

Query: 431 R 433
           +
Sbjct: 156 K 156


>At5g11170.1 68418.m01305 DEAD/DEAH box helicase, putative (RH15)
           DEAD BOX RNA helicase RH15, Arabidopsis thaliana,
           EMBL:ATH010466
          Length = 427

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 27/49 (55%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DVI QA+SG GK
Sbjct: 48  FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGK 96



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 1/61 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F +S LQQI+ S  +  AL+L  TRELA QI    +    +L + K     GG N+
Sbjct: 96  KTAVFVLSTLQQIEPSPGQVSALVLCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNI 155

Query: 431 R 433
           +
Sbjct: 156 K 156


>At2g47330.1 68415.m05908 DEAD/DEAH box helicase, putative similar
           to RNA helicase [Rattus norvegicus] GI:897915; contains
           Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271:
           Helicase conserved C-terminal domain
          Length = 760

 Score = 48.0 bits (109), Expect = 6e-06
 Identities = 22/57 (38%), Positives = 36/57 (63%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D  + V+TF+D     +++  I    +EKP+AIQ +A+   + GRDVI  A++G+GK
Sbjct: 222 DVHRPVKTFEDCGFSSQIMSAIKKQAYEKPTAIQCQALPIVLSGRDVIGIAKTGSGK 278


>At3g06980.1 68416.m00829 DEAD/DEAH box helicase, putative contains
           Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 781

 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 4/88 (4%)
 Frame = +3

Query: 21  GHRRIKVVTMDLREWTLGHLHTDWDQVV----ETFDDMNLKEELLRGIYAYGFEKPSAIQ 188
           G RR  V T D+ +W   +   D  +      +TF ++   E++++ +    F++P+ IQ
Sbjct: 342 GDRRSVVYTRDMDDWRERNKTKDTRETGFFSRKTFAEIGCSEDMMKALKEQNFDRPAHIQ 401

Query: 189 QRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
             A  P I G+  I   QSG+GK L  L
Sbjct: 402 AMAFSPVIDGKSCIIADQSGSGKTLAYL 429


>At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative similar
           to gb|L13612 DEAD-box protein (dbp45A) from Drosophila
           melanogaster and is a member of PF|00270 DEAD/DEAH box
           helicase family
          Length = 491

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 23/59 (38%), Positives = 35/59 (59%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KTA F++ IL ++        AL++ PTRELA Q+ +   ALG  LN +C   +GG ++
Sbjct: 108 KTAAFALPILHRLAEDPYGVFALVVTPTRELAFQLAEQFKALGSCLNLRCSVIVGGMDM 166



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 16/49 (32%), Positives = 26/49 (53%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ + L E  +      G  KP+ +Q   +   + GRDV+  AQ+G+GK
Sbjct: 60  FEGLGLAEWAVETCKELGMRKPTPVQTHCVPKILAGRDVLGLAQTGSGK 108


>At3g18600.1 68416.m02364 DEAD/DEAH box helicase, putative
           non-consensus acceptor splice site AT at exon 2; similar
           to DEAD box helicase protein GB:NP_006764 from [Homo
           sapiens], contains Pfam profile: PF00270  DEAD/DEAH box
           helicase
          Length = 568

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 21/55 (38%), Positives = 34/55 (61%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           TFD ++L E+    I   GF+  + IQ  +I P ++G+DV+  A++G+GK L  L
Sbjct: 90  TFDSLDLSEQTSIAIKEMGFQYMTQIQAGSIQPLLEGKDVLGAARTGSGKTLAFL 144



 Score = 31.1 bits (67), Expect = 0.78
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           +++ PTRELA Q + V   L  H +      IGG N R + +++
Sbjct: 165 IVICPTRELAIQTKNVAEELLKHHSQTVSMVIGGNNRRSEAQRI 208


>At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contains
           Pfam profiles  PF00270:DEAD/DEAH box helicase and
           PF00271:  Helicase conserved C-terminal domain;
           identical to cDNA RH27 helicase, partial GI:4033334
          Length = 633

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 20/56 (35%), Positives = 34/56 (60%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           +TF+ ++L +   + I   GF + + IQ +AI P + G DV+  A++G+GK L  L
Sbjct: 154 KTFESLSLSDNTYKSIKEMGFARMTQIQAKAIPPLMMGEDVLGAARTGSGKTLAFL 209


>At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28)
           identical to cDNA DEAD box RNA helicase, RH28 GI:3776026
          Length = 789

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 21/51 (41%), Positives = 31/51 (60%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +TF ++NL   LLR     G++KP+ IQ   I   + GRD+ A A +G+GK
Sbjct: 167 DTFMELNLSRPLLRACETLGYKKPTPIQAACIPLALTGRDLCASAITGSGK 217



 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 3/81 (3%)
 Frame = +2

Query: 203 ALHPRTRCYRSSPVRNWKTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVI 373
           AL  R  C  S+   + KTA F++  L+++      +   + LIL PTRELA QI  ++ 
Sbjct: 201 ALTGRDLC-ASAITGSGKTAAFALPTLERLLFRPKRVFATRVLILTPTRELAVQIHSMIQ 259

Query: 374 ALGDHLNAKCHACIGGTNVRE 436
            L    + KC   +GG +VRE
Sbjct: 260 NLAQFTDIKCGLIVGGLSVRE 280


>At2g33730.1 68415.m04134 DEAD box RNA helicase, putative similar to
           SP|P23394 Pre-mRNA splicing factor RNA helicase PRP28
           {Saccharomyces cerevisiae}; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain
          Length = 733

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 21/52 (40%), Positives = 34/52 (65%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           + ++++  L  ELL+ +   G++KPS IQ  AI   +Q RDVI  A++G+GK
Sbjct: 312 MRSWEESKLTSELLKAVERAGYKKPSPIQMAAIPLGLQQRDVIGIAETGSGK 363



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 15/40 (37%), Positives = 27/40 (67%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVRE 436
           A+++APTRELAQQI++  +    +L  +  + +GG ++ E
Sbjct: 392 AVVMAPTRELAQQIEEETVKFAHYLGFRVTSIVGGQSIEE 431


>At5g11170.2 68418.m01306 DEAD/DEAH box helicase, putative (RH15)
           DEAD BOX RNA helicase RH15, Arabidopsis thaliana,
           EMBL:ATH010466
          Length = 344

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 1/61 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F +S LQQI+ S  +  AL+L  TRELA QI    +    +L + K     GG N+
Sbjct: 13  KTAVFVLSTLQQIEPSPGQVSALVLCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNI 72

Query: 431 R 433
           +
Sbjct: 73  K 73


>At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9)
           similar to RNA helicases GI:3775995, GI:3775987
           [Arabidopsis thaliana]; contains Pfam profiles PF00270:
           DEAD/DEAH box helicase, PF00271: Helicase conserved
           C-terminal domain
          Length = 610

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 18/49 (36%), Positives = 32/49 (65%)
 Frame = +3

Query: 117 DMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           D+ +  E+++ +   G EK   IQ+  + P ++GRD+I +A++GTGK L
Sbjct: 120 DLGISPEIVKALKGRGIEKLFPIQKAVLEPAMEGRDMIGRARTGTGKTL 168



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = +2

Query: 314 QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           Q L+LAPTRELA+Q++K        L+  C    GGT + + +R+L
Sbjct: 192 QCLVLAPTRELARQVEKEFRESAPSLDTIC--LYGGTPIGQQMREL 235


>At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar to
           RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain, PF00397:
           WW domain
          Length = 1088

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 20/52 (38%), Positives = 32/52 (61%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           TF+   L  E+LR + + GF  P+ IQ +     +Q RD++A A++G+GK L
Sbjct: 436 TFESSGLPPEILRELLSAGFPSPTPIQAQTWPIALQSRDIVAIAKTGSGKTL 487



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 19/45 (42%), Positives = 23/45 (51%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           LILAPTRELA QIQ   +  G      C    GG      +++LE
Sbjct: 511 LILAPTRELATQIQDEALRFGRSSRISCTCLYGGAPKGPQLKELE 555


>At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helicase,
           putative (RH30) strong similarity to ethylene-responsive
           RNA helicase [Lycopersicon esculentum] GI:5669638;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain
          Length = 591

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 21/62 (33%), Positives = 35/62 (56%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           D  + ++ F D N  + +L  I   GF +P+ IQ +     ++GRD+I  A++G+GK L 
Sbjct: 159 DVPKPMKMFQDANFPDNILEAIAKLGFTEPTPIQAQGWPMALKGRDLIGIAETGSGKTLA 218

Query: 267 SL 272
            L
Sbjct: 219 YL 220



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 19/44 (43%), Positives = 21/44 (47%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           LILAPTRELA QIQ+     G     +     GG      IR L
Sbjct: 242 LILAPTRELAVQIQEESRKFGLRSGVRSTCIYGGAPKGPQIRDL 285


>At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helicase,
           putative (RH30) strong similarity to ethylene-responsive
           RNA helicase [Lycopersicon esculentum] GI:5669638;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain
          Length = 484

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 21/62 (33%), Positives = 35/62 (56%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           D  + ++ F D N  + +L  I   GF +P+ IQ +     ++GRD+I  A++G+GK L 
Sbjct: 159 DVPKPMKMFQDANFPDNILEAIAKLGFTEPTPIQAQGWPMALKGRDLIGIAETGSGKTLA 218

Query: 267 SL 272
            L
Sbjct: 219 YL 220



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 19/44 (43%), Positives = 21/44 (47%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           LILAPTRELA QIQ+     G     +     GG      IR L
Sbjct: 242 LILAPTRELAVQIQEESRKFGLRSGVRSTCIYGGAPKGPQIRDL 285


>At3g01540.3 68416.m00084 DEAD box RNA helicase (DRH1) identical to
           RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 619

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +F+      ELLR + + GF  P+ IQ ++    +QGRD++A A++G+GK L
Sbjct: 159 SFEATGFPPELLREVLSAGFSAPTPIQAQSWPIAMQGRDIVAIAKTGSGKTL 210



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 18/45 (40%), Positives = 23/45 (51%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+L+PTRELA QIQ+  +  G      C    GG      +R LE
Sbjct: 234 LVLSPTRELATQIQEEAVKFGRSSRISCTCLYGGAPKGPQLRDLE 278


>At3g01540.2 68416.m00083 DEAD box RNA helicase (DRH1) identical to
           RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 619

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +F+      ELLR + + GF  P+ IQ ++    +QGRD++A A++G+GK L
Sbjct: 159 SFEATGFPPELLREVLSAGFSAPTPIQAQSWPIAMQGRDIVAIAKTGSGKTL 210



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 18/45 (40%), Positives = 23/45 (51%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+L+PTRELA QIQ+  +  G      C    GG      +R LE
Sbjct: 234 LVLSPTRELATQIQEEAVKFGRSSRISCTCLYGGAPKGPQLRDLE 278


>At3g01540.1 68416.m00082 DEAD box RNA helicase (DRH1) identical to
           RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 618

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +F+      ELLR + + GF  P+ IQ ++    +QGRD++A A++G+GK L
Sbjct: 159 SFEATGFPPELLREVLSAGFSAPTPIQAQSWPIAMQGRDIVAIAKTGSGKTL 210



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 18/45 (40%), Positives = 23/45 (51%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+L+PTRELA QIQ+  +  G      C    GG      +R LE
Sbjct: 234 LVLSPTRELATQIQEEAVKFGRSSRISCTCLYGGAPKGPQLRDLE 278


>At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar to
           RNA helicases GI:3775995, GI:3775987 from [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 616

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 17/49 (34%), Positives = 33/49 (67%)
 Frame = +3

Query: 117 DMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++ +  E+++ + + G EK   IQ+  + P ++GRD+I +A++GTGK L
Sbjct: 108 ELGISPEIVKALSSKGIEKLFPIQKAVLEPAMEGRDMIGRARTGTGKTL 156



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 19/45 (42%), Positives = 28/45 (62%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELA+Q++K        L+  C    GGT + + +RQL+
Sbjct: 182 LVLAPTRELARQVEKEFRESAPSLDTIC--LYGGTPIGQQMRQLD 224


>At5g08620.1 68418.m01025 DEAD box RNA helicase (RH25) identical to
           RNA helicase [Arabidopsis thaliana] GI:3776023; contains
           Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271:
           Helicase conserved C-terminal domain
          Length = 563

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/54 (35%), Positives = 33/54 (61%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           FD   L    L+GI   GF+  + +Q+  +   +QG+D++A+A++GTGK +  L
Sbjct: 82  FDQFPLSPLTLKGIEDAGFKTMTVVQEATLPLILQGKDILAKAKTGTGKTVAFL 135


>At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong
           similarity to RNA helicase RH26 [Arabidopsis thaliana]
           GI:3776025; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain; identical to cDNA DEAD box RNA helicase, RH26
           GI:3776024
          Length = 850

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 1/67 (1%)
 Frame = +3

Query: 75  HLHTDWDQVVET-FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           H+ T    + +T FD   L    L+ I   GFE  + +Q+  +   +QG+DV+A+A++GT
Sbjct: 371 HVKTSDSYLSKTRFDQFPLSPLSLKAIKDAGFETMTVVQEATLPIILQGKDVLAKAKTGT 430

Query: 252 GKLLLSL 272
           GK +  L
Sbjct: 431 GKTVAFL 437


>At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA
           helicase DBP2 - Saccharomyces cerevisiae, PID:g5272
          Length = 542

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 2/87 (2%)
 Frame = +3

Query: 12  PKMGHRRIKVVTMDL--REWTLGHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAI 185
           P +  R++    MDL  ++W +     D    ++ F DM     LLR +   G   P+ I
Sbjct: 64  PPLHVRKMSTKQMDLIRKQWHITVNGEDIPPPIKNFMDMKFPSPLLRMLKDKGIMHPTPI 123

Query: 186 QQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           Q + +   + GRD+I  A +G+GK L+
Sbjct: 124 QVQGLPVVLSGRDMIGIAFTGSGKTLV 150


>At3g53110.1 68416.m05853 DEAD/DEAH box helicase, putative RNA
           helicase, Mus musculus, PIR:I49731
          Length = 496

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/43 (44%), Positives = 29/43 (67%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KT  F + +L ++D ++RE QAL + PTRELA Q  +V+  +G
Sbjct: 144 KTTCFVLGMLSRVDPTLREPQALCICPTRELANQNMEVLQKMG 186



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 4/53 (7%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYA-YGFEKPSAIQQRAIMPCIQ---GRDVIAQAQSGTGK 257
           F+D+NL  EL++G+Y    FEKPS IQ  + +P I     + +IAQA +G+GK
Sbjct: 93  FEDLNLSPELMKGLYVEMKFEKPSKIQAIS-LPMIMTPPHKHLIAQAHNGSGK 144


>At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to
           SP|O00571 DEAD-box protein 3 (Helicase-like protein 2)
           {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo
           sapiens] GI:3523150; contains Pfam profiles PF00270:
           DEAD/DEAH box helicase, PF00271: Helicase conserved
           C-terminal domain
          Length = 633

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 21/52 (40%), Positives = 34/52 (65%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V TF +++L E L   I    + KP+ +Q+ AI   ++GRD++A AQ+G+GK
Sbjct: 158 VNTFAEIDLGEALNLNIRRCKYVKPTPVQRHAIPILLEGRDLMACAQTGSGK 209



 Score = 36.3 bits (80), Expect = 0.021
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           A+IL+PTRELA QI             K     GGT + + +R+LE
Sbjct: 240 AVILSPTRELASQIHDEAKKFSYQTGVKVVVAYGGTPINQQLRELE 285


>At1g77050.1 68414.m08971 DEAD/DEAH box helicase, putative similar
           to RNA helicase GI:3776027 from [Arabidopsis thaliana]
          Length = 513

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 2/68 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE--CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F I +L+++   + +   +ALIL+PTR+LA+Q  K    LG   + +    +GG +
Sbjct: 78  KTAAFLIPMLEKLKQHVPQGGVRALILSPTRDLAEQTLKFTKELGKFTDLRVSLLVGGDS 137

Query: 428 VREDIRQL 451
           + +   +L
Sbjct: 138 MEDQFEEL 145



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 16/49 (32%), Positives = 30/49 (61%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ +NL   +   I   G++ P+ IQ++ +   + G DV+A A++G+GK
Sbjct: 30  FESLNLGPNVFNAIKKKGYKVPTPIQRKTMPLILSGVDVVAMARTGSGK 78


>At1g12770.1 68414.m01482 DEAD/DEAH box helicase family protein /
           pentatricopeptide (PPR) repeat-containing protein
           contains Pfam profiles:  PF00271 helicase conserved
           C-terminal domain, PF01535 PPR repeat, PF00270:
           DEAD/DEAH box helicase
          Length = 1145

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 18/56 (32%), Positives = 33/56 (58%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           ++F+++ L + LL  +   GF  P+ +Q  A+   I+G D + Q+ +G+GK L  L
Sbjct: 110 KSFEELGLPDSLLDSLEREGFSVPTDVQSAAVPAIIKGHDAVIQSYTGSGKTLAYL 165



 Score = 29.5 bits (63), Expect = 2.4
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = +2

Query: 308 ECQALILAPTRELAQQI-QKVVIALGDHLNAKCHACIGGTN 427
           E QA+I+AP+REL  QI ++V   LG          +GG N
Sbjct: 191 EIQAMIVAPSRELGMQIVREVEKLLGPVHRRMVQQLVGGAN 231


>At5g26742.1 68418.m03161 DEAD box RNA helicase (RH3) nearly
           identical to RNA helicase [Arabidopsis thaliana]
           GI:3775987; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain, PF00098: Zinc knuckle
          Length = 747

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +3

Query: 120 MNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++L + L   +   G      IQ+  ++P +QGRD+IA+A++GTGK L
Sbjct: 107 LSLPQRLEESLEKRGITHLFPIQRAVLVPALQGRDIIARAKTGTGKTL 154



 Score = 31.9 bits (69), Expect = 0.45
 Identities = 13/28 (46%), Positives = 20/28 (71%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKC 403
           L+LAPTRELA+Q++K +     +L+  C
Sbjct: 184 LVLAPTRELAKQVEKEIKESAPYLSTVC 211


>At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to
           SP|O00571 DEAD-box protein 3 (Helicase-like protein 2)
           {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo
           sapiens] GI:3523150; contains Pfam profiles PF00270:
           DEAD/DEAH box helicase, PF00271: Helicase conserved
           C-terminal domain
          Length = 646

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 21/52 (40%), Positives = 32/52 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V TF +++L E L   I    + KP+ +Q+ AI     GRD++A AQ+G+GK
Sbjct: 145 VNTFAEIDLGEALNLNIQRCKYVKPTPVQRNAIPILAAGRDLMACAQTGSGK 196



 Score = 36.3 bits (80), Expect = 0.021
 Identities = 20/46 (43%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           A+IL+PTRELA QI             K     GGT V + IR+LE
Sbjct: 227 AVILSPTRELACQIHDEARKFSYQTGVKVVVAYGGTPVNQQIRELE 272


>At1g55150.1 68414.m06298 DEAD box RNA helicase, putative (RH20)
           similar to ethylene-responsive RNA helicase GI:5669638
           from [Lycopersicon esculentum]; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain
          Length = 501

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/59 (32%), Positives = 35/59 (59%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           D  + V++F D+   + +L  +   GF +P+ IQ +     ++GRD+I  A++G+GK L
Sbjct: 93  DIPKPVKSFRDVGFPDYVLEEVKKAGFTEPTPIQSQGWPMAMKGRDLIGIAETGSGKTL 151



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 18/45 (40%), Positives = 22/45 (48%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELA QIQ+     G     K     GG      +R L+
Sbjct: 176 LVLAPTRELAVQIQQEASKFGSSSKIKTTCIYGGVPKGPQVRDLQ 220


>At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13)
           similar to RNA helicase GB:CAA09204 from [Arabidopsis
           thaliana]; identical to cDNA DEAD box RNA helicase, RH13
           GI:3776002
          Length = 832

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAI-MPCIQGRDVIAQAQSGTGKLL 263
           +  M L   L++ IY   F++P+ IQ+    +   QG+DVI  A++G+GK L
Sbjct: 192 WSSMRLHPLLMKSIYRLDFKEPTKIQKACFNVAAYQGKDVIGAAETGSGKTL 243



 Score = 30.3 bits (65), Expect = 1.4
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +2

Query: 314 QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           +ALI+ PTRELA Q+ + +     +L+ K    +GG    +  R+L+
Sbjct: 281 RALIITPTRELALQVTEHLENAAKNLSVKVVPIVGGMFSEKQERRLK 327


>At2g40700.1 68415.m05021 DEAD/DEAH box helicase, putative (RH17)
           identical to GB:CAA09207, contains a DEAD/DEAH box
           family ATP-dependent helicas signature; identical to
           cDNA DEAD box RNA helicase, RH17 GI:3776008
          Length = 609

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 17/37 (45%), Positives = 24/37 (64%)
 Frame = +3

Query: 162 GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           GFE P+ +Q +AI   + GRDV+  A +GTGK +  L
Sbjct: 49  GFEAPTLVQAQAIPVILSGRDVLVNAPTGTGKTIAYL 85


>At2g07750.1 68415.m01003 DEAD box RNA helicase, putative similar to
           RNA helicase RH25 [Arabidopsis thaliana] GI:3776023;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain
          Length = 845

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 16/54 (29%), Positives = 30/54 (55%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           FD+  +    L+ + A G  K + +Q   +  C+ G+D + +A++GTGK +  L
Sbjct: 377 FDESCISPLTLKALSASGIVKMTRVQDATLSECLDGKDALVKAKTGTGKSMAFL 430



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 22/46 (47%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIA-LGDHLNAKCHACIGGTNVREDIRQLE 454
           LIL PTRELA QI     A L +H        IGGT  R D ++LE
Sbjct: 456 LILCPTRELASQIAAEGKALLKNHDGIGVQTLIGGTRFRLDQQRLE 501


>At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar to
           RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain, PF00397:
           WW domain
          Length = 713

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 17/40 (42%), Positives = 27/40 (67%)
 Frame = +3

Query: 144 RGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           R +Y+ GF  PS IQ ++    +Q RD++A A++G+GK L
Sbjct: 242 RMVYSAGFSAPSPIQAQSWPIAMQNRDIVAIAKTGSGKTL 281



 Score = 34.7 bits (76), Expect = 0.063
 Identities = 16/45 (35%), Positives = 23/45 (51%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+L+PTRELA QIQ   +  G      C    GG      ++++E
Sbjct: 305 LVLSPTRELATQIQVEALKFGKSSKISCACLYGGAPKGPQLKEIE 349


>At1g63250.1 68414.m07150 DEAD box RNA helicase, putative similar to
           RNA helicase (RH25) [Arabidopsis thaliana] GI:3776023;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain
          Length = 798

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 16/54 (29%), Positives = 30/54 (55%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           FD+  +    L+ + A G  K + +Q   +  C+ G+D + +A++GTGK +  L
Sbjct: 330 FDESCISPLTLKALSASGILKMTRVQDATLSECLDGKDALVKAKTGTGKSMAFL 383



 Score = 32.3 bits (70), Expect = 0.34
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQ---KVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           ALIL PTRELA QI    K ++   D +  +    IGGT  + D ++LE
Sbjct: 408 ALILCPTRELASQIAAEGKALLKFHDGIGVQ--TLIGGTRFKLDQQRLE 454


>At5g63630.1 68418.m07989 DEAD box RNA helicase, putative strong
           similarity to RNA helicase RH25 [Arabidopsis thaliana]
           GI:3776023; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain; identical to cDNA DEAD box RNA helicase, RH31
           GI:3776030
          Length = 522

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           FD   L    L+ I   G+E  + +Q+  +   ++G+DV+A+A++GTGK +  L
Sbjct: 56  FDHYPLSPLSLKAIKDAGYETMTVVQEATLPIILKGKDVLAKAKTGTGKTVAFL 109


>At5g19210.2 68418.m02287 DEAD/DEAH box helicase, putative
           EUKARYOTIC INITIATION FACTOR 4A-II (EIF-4A-II), Homo
           sapiens, SWISSPROT:IF42_HUMAN
          Length = 472

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 6/67 (8%)
 Frame = +3

Query: 132 EELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK------LLLSLYRFYNKS 293
           E +L  +   GF  P+ IQ+ A+     GRD I  AQ+G+GK      L+ SL      S
Sbjct: 85  EHILHRMEEIGFVFPTDIQREALPTLFTGRDCILHAQTGSGKTLTYLLLIFSLINPQRSS 144

Query: 294 IQAFVNV 314
           +QA + V
Sbjct: 145 VQAVIVV 151



 Score = 34.3 bits (75), Expect = 0.083
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 224 CYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKV 367
           C   +   + KT T+ + I   I+      QA+I+ PTREL  Q+ KV
Sbjct: 116 CILHAQTGSGKTLTYLLLIFSLINPQRSSVQAVIVVPTRELGMQVTKV 163


>At1g31970.1 68414.m03931 DEAD/DEAH box helicase, putative similar
           to p68 RNA helicase [Schizosaccharomyces pombe]
           GI:173419
          Length = 537

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 22/54 (40%), Positives = 31/54 (57%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           ++TF + NL E +L       FEKPS IQ       + GRD+I  A++G+GK L
Sbjct: 115 LKTFAESNLPENVLDCCKT--FEKPSPIQSHTWPFLLDGRDLIGIAKTGSGKTL 166



 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/36 (41%), Positives = 21/36 (58%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           L+L+PTRELA QI  V+   G+    K     GG++
Sbjct: 195 LVLSPTRELAVQISDVLREAGEPCGLKSICVYGGSS 230


>At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11)
           similar to RNA helicase DBY protein [Mus musculus]
           GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like
           protein 2) {Homo sapiens}; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain; identical to cDNA DEAD box
           RNA helicase, RH11 GI:3775998
          Length = 612

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 19/52 (36%), Positives = 32/52 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V TF D++L + L   I    + +P+ +Q+ AI   +  RD++A AQ+G+GK
Sbjct: 150 VNTFADIDLGDALNLNIRRCKYVRPTPVQRHAIPILLAERDLMACAQTGSGK 201



 Score = 35.1 bits (77), Expect = 0.048
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           A+IL+PTRELA QI             K     GGT + + +R+LE
Sbjct: 232 AVILSPTRELACQIHDEAKKFSYQTGVKVVVAYGGTPIHQQLRELE 277


>At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11)
           similar to RNA helicase DBY protein [Mus musculus]
           GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like
           protein 2) {Homo sapiens}; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain; identical to cDNA DEAD box
           RNA helicase, RH11 GI:3775998
          Length = 612

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 19/52 (36%), Positives = 32/52 (61%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V TF D++L + L   I    + +P+ +Q+ AI   +  RD++A AQ+G+GK
Sbjct: 150 VNTFADIDLGDALNLNIRRCKYVRPTPVQRHAIPILLAERDLMACAQTGSGK 201



 Score = 35.1 bits (77), Expect = 0.048
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           A+IL+PTRELA QI             K     GGT + + +R+LE
Sbjct: 232 AVILSPTRELACQIHDEAKKFSYQTGVKVVVAYGGTPIHQQLRELE 277


>At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to
           RNA helicase [Rattus norvegicus] GI:897915; contains
           Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271:
           Helicase conserved C-terminal domain
          Length = 1166

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L++APTREL QQI   +      L  +C    GG+ V + I +L+
Sbjct: 606 LVMAPTRELVQQIHSDIRKFSKPLGIRCVPVYGGSGVAQQISELK 650



 Score = 35.5 bits (78), Expect = 0.036
 Identities = 18/59 (30%), Positives = 32/59 (54%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           D  + ++ +    L  ++L  +    +EKP  IQ +A+   + GRD I  A++G+GK L
Sbjct: 523 DVPRPIKFWHQTGLTSKILDTMKKLNYEKPMPIQTQALPIIMSGRDCIGVAKTGSGKTL 581


>At5g51280.1 68418.m06357 DEAD-box protein abstrakt, putative 
          Length = 591

 Score = 36.3 bits (80), Expect = 0.021
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 2/87 (2%)
 Frame = +3

Query: 12  PKMGHRRIKVVTMDL--REWTLGHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAI 185
           P +  R++     DL  ++W +     D    ++ F DM     +L  +   G  +P+ I
Sbjct: 113 PPLHIRKMSSKQRDLIRKQWHIIVNGDDIPPPIKNFKDMKFPRPVLDTLKEKGIVQPTPI 172

Query: 186 QQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           Q + +   + GRD+I  A +G+GK L+
Sbjct: 173 QVQGLPVILAGRDMIGIAFTGSGKTLV 199


>At3g09720.1 68416.m01151 DEAD/DEAH box helicase, putative similar
           to RNA helicase involved in rRNA processing GB:6321267
           from [Saccharomyces cerevisiae]c, ontains DEAD and DEAH
           box domain
          Length = 541

 Score = 36.3 bits (80), Expect = 0.021
 Identities = 16/40 (40%), Positives = 27/40 (67%)
 Frame = +3

Query: 138 LLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +LR +   GF++P+ IQ++AI   + GR+  A A +G+GK
Sbjct: 152 ILRNLAELGFKEPTPIQRQAIPILLSGRECFACAPTGSGK 191



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%)
 Frame = +2

Query: 224 CYRSSPVRNWKTATFSISILQQIDT-SIRECQALILAPTRELAQQ 355
           C+  +P  + KT  F   +L ++   S    +A+IL+P RELA Q
Sbjct: 181 CFACAPTGSGKTFAFICPMLIKLKRPSTDGIRAVILSPARELAAQ 225


>At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative similar
           to RNA helicase GB:A57514 GI:897915 from [Rattus
           norvegicus]; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain
          Length = 989

 Score = 36.3 bits (80), Expect = 0.021
 Identities = 18/59 (30%), Positives = 32/59 (54%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           D  + ++ +    L  ++L  +    +EKP  IQ +A+   + GRD I  A++G+GK L
Sbjct: 390 DVPRPIQFWHQTGLTSKILDTLKKLNYEKPMPIQAQALPIIMSGRDCIGVAKTGSGKTL 448



 Score = 34.7 bits (76), Expect = 0.063
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L++APTREL QQI   +      L   C    GG+ V + I +L+
Sbjct: 473 LVMAPTRELVQQIYSDIRKFSKALGIICVPVYGGSGVAQQISELK 517


>At1g59990.1 68414.m06758 DEAD/DEAH box helicase, putative (RH22)
           similar to RNA helicase GI:3776015 from [Arabidopsis
           thaliana]; contains Pfam profiles PF00271: Helicase
           conserved C-terminal domain, PF00270: DEAD/DEAH box
           helicase; matches EST OAO811-2
          Length = 581

 Score = 34.3 bits (75), Expect = 0.083
 Identities = 15/50 (30%), Positives = 28/50 (56%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++  + L + +   +   GF++PS  Q   I   + G+DVI  A++G+GK
Sbjct: 81  SWKSLGLSDNVSIALRDSGFDRPSLTQAVCIPSILSGKDVIVAAETGSGK 130


>At4g09730.1 68417.m01598 DEAD/DEAH box helicase, putative RNA
           helicase -Mus musculus,PIR2:I84741
          Length = 621

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 14/46 (30%), Positives = 26/46 (56%)
 Frame = +2

Query: 296 TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           T  R  + ++L PTREL++Q+ +V  ++  H   +     GG+ +R
Sbjct: 185 TKPRRPRTVVLCPTRELSEQVYRVAKSISHHARFRSILVSGGSRIR 230


>At3g02065.2 68416.m00170 DEAD/DEAH box helicase family protein
           contains Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 505

 Score = 32.3 bits (70), Expect = 0.34
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 8/71 (11%)
 Frame = +2

Query: 233 SSPVRNWKTATFSISILQQIDT--------SIRECQALILAPTRELAQQIQKVVIALGDH 388
           S+   + KTA+F + I+ +  T          R   A++LAPTREL  Q++     LG  
Sbjct: 153 SADTGSGKTASFLVPIISRCTTYHSEHPSDQRRNPLAMVLAPTRELCVQVEDQAKMLGKG 212

Query: 389 LNAKCHACIGG 421
           L  K    +GG
Sbjct: 213 LPFKTALVVGG 223


>At3g02065.1 68416.m00171 DEAD/DEAH box helicase family protein
           contains Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 368

 Score = 32.3 bits (70), Expect = 0.34
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 8/71 (11%)
 Frame = +2

Query: 233 SSPVRNWKTATFSISILQQIDT--------SIRECQALILAPTRELAQQIQKVVIALGDH 388
           S+   + KTA+F + I+ +  T          R   A++LAPTREL  Q++     LG  
Sbjct: 16  SADTGSGKTASFLVPIISRCTTYHSEHPSDQRRNPLAMVLAPTRELCVQVEDQAKMLGKG 75

Query: 389 LNAKCHACIGG 421
           L  K    +GG
Sbjct: 76  LPFKTALVVGG 86


>At5g54910.1 68418.m06839 DEAD/DEAH box helicase, putative 
          Length = 739

 Score = 31.9 bits (69), Expect = 0.45
 Identities = 15/54 (27%), Positives = 29/54 (53%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           V  F  + + ++  RG+    +   + +Q  AI   + GRD++  A++G+GK L
Sbjct: 70  VRKFAQLPISDKTKRGLKDAKYVDMTDVQSAAIPHALCGRDILGAARTGSGKTL 123


>At1g71370.1 68414.m08239 DEAD/DEAH box helicase, putative similar
           to ATP-dependent RNA helicase GB:6321111 from (S.
           cerevisiae)
          Length = 558

 Score = 31.9 bits (69), Expect = 0.45
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 308 ECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNVREDIRQLE 454
           +   +I++PTREL+ QI KV       L N      +GG  V  D+  LE
Sbjct: 90  QVMGVIISPTRELSAQIHKVAEPFVSTLPNVNSVLLVGGREVEADMNTLE 139



 Score = 31.5 bits (68), Expect = 0.59
 Identities = 16/52 (30%), Positives = 26/52 (50%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRF 281
           L E+++  +   GFE  + +Q   I      +DV+  A +G+GK L  L  F
Sbjct: 23  LSEDIIEALDRSGFEVCTPVQAETIPFLCSHKDVVVDAATGSGKTLAFLLPF 74


>At1g71280.1 68414.m08226 DEAD/DEAH box helicase, putative contains
           Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 465

 Score = 31.5 bits (68), Expect = 0.59
 Identities = 16/52 (30%), Positives = 26/52 (50%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRF 281
           L E+++  +   GFE  + +Q   I      +DV+  A +G+GK L  L  F
Sbjct: 24  LSEDIIEALDRSGFEVCTPVQAETIPFLCSHKDVVVDAATGSGKTLAFLLPF 75



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +2

Query: 308 ECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVRED 439
           +   +I++PTREL+ QI KV  A+     AKC       N  E+
Sbjct: 91  QVMGVIISPTRELSAQIHKVARAVRLDF-AKCREVEADMNTLEE 133


>At3g49970.1 68416.m05464 phototropic-responsive protein, putative
           similar to root phototropism RPT2 [Arabidopsis thaliana]
           gi|6959488|gb|AAF33112, a signal transducer of
           phototropic response PMID:10662859
          Length = 526

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 14/59 (23%), Positives = 33/59 (55%)
 Frame = -3

Query: 227 NIASLDARHYCALLDCRRFFKTIGVYASQQFFFEVHVIEGFDNLIPVGVQVSQGPFPEV 51
           NI+ ++ +  C+L+DC++  + +  +A+Q   F+ + +   D+  P   + +  P PE+
Sbjct: 373 NISEVEKKKVCSLMDCKKLSRDVYAHAAQNDRFQEN-LSNSDSPAPATAEKTLSP-PEL 429


>At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing
           protein contains Pfam profile PF00515 TPR Domain
          Length = 691

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 14/53 (26%), Positives = 33/53 (62%), Gaps = 2/53 (3%)
 Frame = +2

Query: 269 SISILQQIDTSIREC-QALILAPTRELA-QQIQKVVIALGDHLNAKCHACIGG 421
           +++ L+++  +++EC +A+ + P+   A Q++  + + LG+  NA+ H C  G
Sbjct: 263 ALTALRRLGEAVKECLEAVRIDPSYSRAHQRLASLYLRLGEAENARRHICFSG 315


>At5g05450.1 68418.m00587 DEAD/DEAH box helicase, putative (RH18) 
          Length = 593

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = +2

Query: 308 ECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNVREDIRQLE 454
           +   +I++PTREL+ QI  V       L N      +GG  V+ D++ +E
Sbjct: 90  QVMGVIISPTRELSTQIYNVAQPFVSTLANVNSVLLVGGREVKADMKIIE 139


>At4g14365.1 68417.m02213 zinc finger (C3HC4-type RING finger)
           family protein / ankyrin repeat family protein contains
           Pfam profile: PF00097 zinc finger, C3HC4 type (RING
           finger) and Pfam profile: PF00023 ankyrin repeat
          Length = 376

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           LILA T +    + K ++ LG ++NA    C GGT
Sbjct: 46  LILACTNDDLYDVAKTLLELGSNVNAYRSGCNGGT 80


>At2g04620.1 68415.m00470 cation efflux family protein potential
           member of the cation diffusion facilitator (CDF) family,
           or cation efflux (CE) family, see PMID:11500563
          Length = 798

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 13/36 (36%), Positives = 17/36 (47%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQELS 369
           HH H+HH     + H H   +C H   H  +HQ  S
Sbjct: 594 HHEHDHH----HHSHSHKHEECNHN--HDHEHQSHS 623



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 14/33 (42%), Positives = 16/33 (48%)
 Frame = -3

Query: 476 HHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQ 378
           +H HEH S      H H   +C H   H SDHQ
Sbjct: 614 NHDHEHQS------HSHNHEECNHNHDHHSDHQ 640


>At4g24430.1 68417.m03502 expressed protein
          Length = 487

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
 Frame = -2

Query: 498 IYTTLEC-PPRT*TPLSSWRISSRTLVPPMQAWHLAF 391
           ++T L C P +T  PLS W+ +   ++  +Q+W   F
Sbjct: 130 VFTYLNCLPDKTSDPLSLWQDAKNQMLTEVQSWPYDF 166


>At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containing
           protein contains Pfam profile PF00515 TPR Domain
          Length = 682

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 2/75 (2%)
 Frame = +2

Query: 203 ALHPRTRCYRSSPVRNWKTATFSISILQQIDTSIREC-QALILAPTRELA-QQIQKVVIA 376
           +L P    YRS+     + A  + S   +++ +++EC +A+   P+   A Q++  + + 
Sbjct: 239 SLSPENPAYRSN-----RAAALAAS--GRLEEAVKECLEAVRCDPSYARAHQRLASLYLR 291

Query: 377 LGDHLNAKCHACIGG 421
           LG+  NA+ H C+ G
Sbjct: 292 LGEAENARRHLCVSG 306


>At5g18910.1 68418.m02246 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 511

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 10/28 (35%), Positives = 14/28 (50%)
 Frame = -3

Query: 506 IISYTRPWSAHHVHEHHSPVGEYLHGHW 423
           ++S +     HH H HH   G   +GHW
Sbjct: 90  VVSTSDSSETHHHHHHHHSSGGPNNGHW 117


>At3g10810.1 68416.m01301 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 Zinc
           finger, C3HC4 type (RING finger)
          Length = 496

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 16/41 (39%), Positives = 17/41 (41%)
 Frame = -3

Query: 488 PWSAHHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQELSP 366
           P S HH H HH     + H H  H   H   H   H  LSP
Sbjct: 327 PHSKHHHHHHH-----HHHHHHHHHHNH---HHHHHHNLSP 359


>At3g53720.1 68416.m05934 cation/hydrogen exchanger, putative
           (CHX20) monovalent cation:proton antiporter family 2
           (CPA2) member, PMID:11500563
          Length = 842

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 10/24 (41%), Positives = 14/24 (58%)
 Frame = -3

Query: 515 TTIIISYTRPWSAHHVHEHHSPVG 444
           T II+ + + W+A H H HH   G
Sbjct: 572 TMIILPFHKRWNADHGHSHHHQDG 595


>At1g01950.1 68414.m00113 armadillo/beta-catenin repeat family
           protein / kinesin motor family protein similar to
           kinesin-like protein GB:CAB41097 GI:5541717 from
           [Arabidopsis thaliana]; contains Pfam profiles PF00225:
           Kinesin motor domain, PF00514:
           Armadillo/beta-catenin-like repeat
          Length = 894

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 13/57 (22%), Positives = 26/57 (45%)
 Frame = -3

Query: 569 FSSASSRTKSLMVLA*KRTTIIISYTRPWSAHHVHEHHSPVGEYLHGHWCHQCKHGI 399
           F+   SR  +  V +  R+ +I     PW   H ++  +P+  ++    CH  +H +
Sbjct: 788 FAKCESRATTQGVKS-GRSLLIEDGALPWIVQHANDEAAPIRRHIELALCHLAQHEV 843


>At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly
           identical to RNA helicase [Arabidopsis thaliana]
           GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain
          Length = 671

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 15/39 (38%), Positives = 18/39 (46%)
 Frame = +2

Query: 305 RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           R    L+L PTRELA+Q+     A G  L        GG
Sbjct: 173 RSPSVLVLLPTRELAKQVAADFDAYGGSLGLSSCCLYGG 211


>At4g26510.2 68417.m03818 uracil phosphoribosyltransferase / UMP
           pyrophosphorylase (UPT1) nearly identical to SP|O65583
           Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP
           pyrophosphorylase) (UPRTase) {Arabidopsis thaliana}
          Length = 402

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +3

Query: 123 NLKEELLRGIYAYGFEKPSAIQQRAIMPCIQ 215
           NL EE L  ++ Y F+ P A     ++ C++
Sbjct: 22  NLTEEELARVHEYNFDHPDAFDTEHLLSCME 52


>At4g26510.1 68417.m03817 uracil phosphoribosyltransferase / UMP
           pyrophosphorylase (UPT1) nearly identical to SP|O65583
           Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP
           pyrophosphorylase) (UPRTase) {Arabidopsis thaliana}
          Length = 402

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +3

Query: 123 NLKEELLRGIYAYGFEKPSAIQQRAIMPCIQ 215
           NL EE L  ++ Y F+ P A     ++ C++
Sbjct: 22  NLTEEELARVHEYNFDHPDAFDTEHLLSCME 52


>At1g76010.1 68414.m08825 expressed protein
          Length = 350

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 10/19 (52%), Positives = 13/19 (68%)
 Frame = +2

Query: 17  NGPSKDQGSYDGPPGMDPG 73
           +GPS+ +G YDGP G   G
Sbjct: 299 DGPSQGRGGYDGPQGRGRG 317


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,595,877
Number of Sequences: 28952
Number of extensions: 396555
Number of successful extensions: 1275
Number of sequences better than 10.0: 76
Number of HSP's better than 10.0 without gapping: 1116
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1263
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1584903024
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).