SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30048
         (717 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g58310.1 68416.m06500 receptor-like protein kinase-related co...    33   0.14 
At5g26200.1 68418.m03118 mitochondrial substrate carrier family ...    32   0.44 
At5g67310.1 68418.m08488 cytochrome P450 family protein                28   7.1  

>At3g58310.1 68416.m06500 receptor-like protein kinase-related
           contains Pfam profile: PF01657 Domain of unknown
           function that is usually associated with protein kinase
           domain Pfam:PF00069; belongs to a family which includes
           receptor-like kinase family proteins
          Length = 258

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 24/66 (36%), Positives = 32/66 (48%)
 Frame = +1

Query: 370 KVEEPAAQPEDSKTEVASLTVAEISIRRNT*LLLMAEGSVRLRLASLRTMVKARFDLWLL 549
           KV +PA     +K  +  LT    + RR+  LLL   G ++L    L  MV+ R DLW  
Sbjct: 157 KVSDPALFNVKTKALLTELTAK--ATRRSDKLLLYETGEMKLGKMKLYGMVQCRRDLW-F 213

Query: 550 PVAKRC 567
            V K C
Sbjct: 214 TVCKTC 219


>At5g26200.1 68418.m03118 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 342

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 17/35 (48%), Positives = 24/35 (68%)
 Frame = -1

Query: 147 LTESSILGATSRIG*AGTTSFSSATGIAKLTAAKA 43
           +T+SS+  AT R+G + TTS + A G A LT+A A
Sbjct: 112 ITKSSVGQATVRLGLSDTTSLAVANGAAGLTSAVA 146


>At5g67310.1 68418.m08488 cytochrome P450 family protein
          Length = 507

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 14/49 (28%), Positives = 28/49 (57%)
 Frame = -2

Query: 584 QEIASQHRFATGRSQRSNLAFTMVRRLASLSRTEPSAISSN*VFLLIEI 438
           Q++  +HR   G+++   L  TM+ RL SL  +EP   + + +  L+++
Sbjct: 262 QKLVDEHRKNRGKAE---LEKTMITRLLSLQESEPECYTDDIIKGLVQV 307


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,445,584
Number of Sequences: 28952
Number of extensions: 237069
Number of successful extensions: 538
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 527
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 538
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1555552968
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).