SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30047
         (794 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g28350.1 68418.m03442 expressed protein                             30   1.5  
At2g19870.1 68415.m02323 tRNA/rRNA methyltransferase (SpoU) fami...    30   1.5  
At4g36270.1 68417.m05158 ATP-binding region, ATPase-like domain-...    29   4.7  
At1g80210.1 68414.m09387 expressed protein                             29   4.7  
At3g17850.1 68416.m02275 protein kinase, putative similar to IRE...    28   6.2  
At1g30835.1 68414.m03770 expressed protein                             28   6.2  
At3g29830.1 68416.m03796 F-box family protein contains Pfam:PF00...    28   8.2  
At1g65120.2 68414.m07382 ubiquitin carboxyl-terminal hydrolase-r...    28   8.2  
At1g65120.1 68414.m07383 ubiquitin carboxyl-terminal hydrolase-r...    28   8.2  
At1g58310.1 68414.m06633 F-box family protein contains F-box dom...    28   8.2  

>At5g28350.1 68418.m03442 expressed protein
          Length = 1127

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 16/38 (42%), Positives = 19/38 (50%)
 Frame = -2

Query: 334 SGQAALIVKYISSFFLHFSREKLQPRRKSSGTRLPTHL 221
           S  A LI    SSFFLH  + K   +R   G R P+ L
Sbjct: 76  SPDAKLIAVLTSSFFLHIYKIKFTDKRVKPGERQPSEL 113


>At2g19870.1 68415.m02323 tRNA/rRNA methyltransferase (SpoU) family
           protein similar to SP|P25270 Ribose methyltransferase
           PET56 (EC 2.1.1.-) {Saccharomyces cerevisiae}; contains
           Pfam profile PF00588: SpoU rRNA Methylase (RNA
           methyltransferase, TrmH) family
          Length = 589

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = +1

Query: 106 QPSGELWKKIREELNE-DVNTRAQDLAAIKEWLRKQPHLPDEWEDA 240
           +P    W +I+   N  DV  + +D AA + W R++      W++A
Sbjct: 258 EPDNTRWSEIKNRFNRYDVRDQGRDDAAYRNWNRQESWGRKTWQEA 303


>At4g36270.1 68417.m05158 ATP-binding region, ATPase-like
           domain-containing protein low similarity to microrchidia
           [Mus musculus] GI:5410255; contains Pfam profile
           PF02518: ATPase, histidine kinase-, DNA gyrase B-, and
           HSP90-like domain protein
          Length = 625

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)
 Frame = +3

Query: 540 RE*AGDVYVLDASILMPSHLRQDF-TSSAEEILSFVYRKLIQ*NWK-EIHVY 689
           R  +G V VL+A+ + P+H +QDF  SS  + L    +K++   W    HV+
Sbjct: 406 RRGSGVVGVLEANFIEPAHDKQDFERSSLFQRLEARLKKIVSNYWNTHCHVF 457


>At1g80210.1 68414.m09387 expressed protein
          Length = 354

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 15/51 (29%), Positives = 26/51 (50%)
 Frame = -1

Query: 575 SVQYVNVSSLFPRLLHAVLHLRYHCKFEDIIKLVRVQVLVQCSGDGYSSTL 423
           S  YV   +++  L    + L + C  ED  K+ R+QV+   S DG  +++
Sbjct: 82  SFPYVRTQAMYQLLDSGFIGLIFSCFSEDANKVGRIQVIAFQSSDGKPNSI 132


>At3g17850.1 68416.m02275 protein kinase, putative similar to IRE
           (incomplete root hair elongation) [Arabidopsis thaliana]
           gi|6729346|dbj|BAA89783; contains protein kinase domain
           Pfam:PF00069
          Length = 1296

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +1

Query: 124 WKKIREELNEDVNTRAQDLAAIKEW-LRKQPHLPDEWEDACLMTFSEAVASP 276
           ++K +EE+N D+   A DL  + E      P   + +ED  ++  S A+ +P
Sbjct: 331 FEKAKEEVNSDLAVFAADLVGVLEKNAESHPEWEETFEDLLILARSCAMTTP 382


>At1g30835.1 68414.m03770 expressed protein
          Length = 132

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = +2

Query: 329 PRVLREQRRNQTRANGPAE*SPRTYTPWLDASRSTSNHRQSTGQEP 466
           PR L E + N +   GP +  PRT +P   A R TS    ++  EP
Sbjct: 29  PRDLSEPKTNLSGKGGPPQPRPRTSSP-QQARRETSKLTFNSTDEP 73


>At3g29830.1 68416.m03796 F-box family protein contains Pfam:PF00646
           F-box domain
          Length = 464

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 18/65 (27%), Positives = 33/65 (50%)
 Frame = -2

Query: 658 ISFLYTNERISSALLVKSWRRWLGIRIEASST*TSPAYSLDFFTQSYISDIIASLKTSLS 479
           +SFL   + + +++L K WR    I  EA +     +  +D     Y+S  ++ ++  L+
Sbjct: 22  LSFLSFKDNVKTSILSKRWRN---ICYEAKNISFKESEYVDISVFDYVSKRVSFVRYMLN 78

Query: 478 WFVSR 464
           W VSR
Sbjct: 79  W-VSR 82


>At1g65120.2 68414.m07382 ubiquitin carboxyl-terminal
            hydrolase-related contains Pfam profiles PF00443:
            Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein
            of unknown function (DUF629), PF04781: Protein of unknown
            function (DUF627)
          Length = 1147

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 5/81 (6%)
 Frame = -1

Query: 395  LGSIQQVH*LWSG----YVSVREEL-WASSPHREVHIKFLFTFLKGEATASEKVIRHASS 231
            L S+++VH L S      V++ E L W  SP +E  +  LFT  + E     K  R+ + 
Sbjct: 916  LASLEEVHSLSSDADEVVVTILEFLHWWKSPEKESLVTRLFTLEEYERMRCTKCRRNPNY 975

Query: 230  HSSGRWGCFLSHSLIAAKSCA 168
                 +G  ++ + I    CA
Sbjct: 976  PEQSSYGIVMAANSIRNLKCA 996


>At1g65120.1 68414.m07383 ubiquitin carboxyl-terminal
            hydrolase-related contains Pfam profiles PF00443:
            Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein
            of unknown function (DUF629), PF04781: Protein of unknown
            function (DUF627)
          Length = 1121

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 5/81 (6%)
 Frame = -1

Query: 395  LGSIQQVH*LWSG----YVSVREEL-WASSPHREVHIKFLFTFLKGEATASEKVIRHASS 231
            L S+++VH L S      V++ E L W  SP +E  +  LFT  + E     K  R+ + 
Sbjct: 916  LASLEEVHSLSSDADEVVVTILEFLHWWKSPEKESLVTRLFTLEEYERMRCTKCRRNPNY 975

Query: 230  HSSGRWGCFLSHSLIAAKSCA 168
                 +G  ++ + I    CA
Sbjct: 976  PEQSSYGIVMAANSIRNLKCA 996


>At1g58310.1 68414.m06633 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 505

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = -2

Query: 664 HWISFLYTNERISSALLVKSWR 599
           H +SFL T E  S+++L K WR
Sbjct: 20  HILSFLNTKEAASTSVLAKKWR 41


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,471,239
Number of Sequences: 28952
Number of extensions: 411114
Number of successful extensions: 1259
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1214
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1257
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1794809600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).