SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30041
         (747 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g49370.1 68418.m06110 hypothetical protein                          29   3.3  
At4g11770.1 68417.m01876 kelch repeat-containing F-box family pr...    29   4.3  
At1g57770.1 68414.m06554 amine oxidase family contains similarit...    29   4.3  

>At5g49370.1 68418.m06110 hypothetical protein
          Length = 118

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = +3

Query: 546 DYVDKQEFFELYVLFL*INSHTFTHRIQDGKMEGFTKMAPSGVTL*IRPEHTA 704
           DY+++ E F LYV+    N+    HRI    ++   K     +   I P+H+A
Sbjct: 53  DYMERSEVFNLYVIDEDDNATLLAHRI---SIDNIYKQQDDSIISWIDPQHSA 102


>At4g11770.1 68417.m01876 kelch repeat-containing F-box family
           protein contains F-box domain Pfam:PF00646 and Kelch
           motif Pfam:PF01344
          Length = 396

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = +1

Query: 376 YPLFYPFSVWKGSKERHFKVLKLSPERSQLRWRHSTI 486
           Y +FY   +W  S+ R+++VLK   +  +LR R S I
Sbjct: 291 YMVFYKRLIWYDSEVRYWRVLKGLEKLPKLRHRRSCI 327


>At1g57770.1 68414.m06554 amine oxidase family contains similarity
           to carotenoid isomerase [Lycopersicon esculentum]
           GI:19550437, phytoene dehydrogenase (PDH1) GI:433144
           from (Cercospora nicotianae); contains Pfam profile
           PF01593 amine oxidase, flavin-containing
          Length = 574

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = +1

Query: 391 PFSVWKGSKERHFKVLKLSPERSQLRWR 474
           PF +W+G   R  +   L  +RS++ WR
Sbjct: 447 PFGLWEGLDRRSAEYKNLKSQRSEVMWR 474


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,022,216
Number of Sequences: 28952
Number of extensions: 321287
Number of successful extensions: 596
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 588
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 596
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1653386488
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).