SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30038
         (661 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496...   184   5e-47
At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A...   184   6e-47
At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497...   184   6e-47
At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S...   182   2e-46
At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A...   182   2e-46
At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A...   182   2e-46
At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A...   182   2e-46
At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A...   181   3e-46
At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A...   181   3e-46
At2g42100.1 68415.m05205 actin, putative very strong similarity ...   166   1e-41
At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara...   160   9e-40
At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac...   159   2e-39
At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i...   117   6e-27
At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica...   101   3e-22
At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id...    89   2e-18
At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica...    74   7e-14
At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identica...    62   3e-10
At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i...    58   4e-09
At3g12380.1 68416.m01543 actin/actin-like family protein similar...    52   3e-07
At5g56180.2 68418.m07009 actin-related protein, putative (ARP8) ...    36   0.032
At5g56180.1 68418.m07008 actin-related protein, putative (ARP8) ...    36   0.032
At5g01040.1 68418.m00007 laccase family protein / diphenol oxida...    34   0.096
At1g16690.2 68414.m01999 transcription factor-related similar to...    30   1.6  
At1g16690.1 68414.m01998 transcription factor-related similar to...    30   1.6  
At3g07870.1 68416.m00962 F-box family protein contains F-box dom...    26   2.0  
At5g29020.1 68418.m03592 hypothetical protein                          29   3.6  
At2g33460.1 68415.m04101 p21-rho-binding domain-containing prote...    28   6.3  
At5g06610.1 68418.m00747 expressed protein contains Pfam profile...    27   8.4  
At4g01535.1 68417.m00199 hypothetical protein                          27   8.4  
At3g27530.1 68416.m03441 vesicle tethering family protein contai...    27   8.4  
At2g25565.1 68415.m03060 hypothetical protein                          27   8.4  
At2g21330.1 68415.m02538 fructose-bisphosphate aldolase, putativ...    27   8.4  
At1g62420.1 68414.m07042 expressed protein contains Pfam profile...    27   8.4  

>At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496
           Actin 11 {Arabidopsis thaliana}
          Length = 377

 Score =  184 bits (448), Expect = 5e-47
 Identities = 83/85 (97%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNTPAMYVAIQAVLSLYASGRTTGI 153



 Score =  121 bits (292), Expect = 4e-28
 Identities = 56/68 (82%), Positives = 60/68 (88%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 199


>At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494
           Actin 4 {Arabidopsis thaliana}
          Length = 377

 Score =  184 bits (447), Expect = 6e-47
 Identities = 83/85 (97%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNTPAMYVAIQAVLSLYASGRTTGI 153



 Score =  121 bits (292), Expect = 4e-28
 Identities = 56/68 (82%), Positives = 60/68 (88%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 97.5 bits (232), Expect = 7e-21
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERG 199


>At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497
           Actin 12 {Arabidopsis thaliana}
          Length = 377

 Score =  184 bits (447), Expect = 6e-47
 Identities = 83/85 (97%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNTPAMYVAIQAVLSLYASGRTTGI 153



 Score =  121 bits (292), Expect = 4e-28
 Identities = 56/68 (82%), Positives = 60/68 (88%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 97.5 bits (232), Expect = 7e-21
 Identities = 45/46 (97%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERG 199


>At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to
           SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana}
          Length = 377

 Score =  182 bits (443), Expect = 2e-46
 Identities = 82/85 (96%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  121 bits (292), Expect = 4e-28
 Identities = 56/68 (82%), Positives = 60/68 (88%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 45/46 (97%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERG 199


>At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 377

 Score =  182 bits (442), Expect = 2e-46
 Identities = 80/85 (94%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNSPAMYVAIQAVLSLYASGRTTGI 153



 Score =  117 bits (281), Expect = 8e-27
 Identities = 52/68 (76%), Positives = 59/68 (86%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDEAQSKR
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEG++LPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGFSLPHAILRLDLAGRDLTDYLMKILTERG 199


>At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292
           Actin 2 {Arabidopsis thaliana}; nearly identical to
           SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and
           to At1g49240
          Length = 371

 Score =  182 bits (442), Expect = 2e-46
 Identities = 80/85 (94%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNSPAMYVAIQAVLSLYASGRTTGI 153



 Score =  117 bits (281), Expect = 8e-27
 Identities = 52/68 (76%), Positives = 59/68 (86%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDEAQSKR
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEG++LPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGFSLPHAILRLDLAGRDLTDYLMKILTERG 199


>At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293
           Actin 8 {Arabidopsis thaliana}; nearly identical to
           SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and
           to At3g18780
          Length = 377

 Score =  182 bits (442), Expect = 2e-46
 Identities = 80/85 (94%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHG+V+NWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN+PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNSPAMYVAIQAVLSLYASGRTTGI 153



 Score =  117 bits (281), Expect = 8e-27
 Identities = 52/68 (76%), Positives = 59/68 (86%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           +++  +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDEAQSKR
Sbjct: 5   DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 96.7 bits (230), Expect = 1e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEG++LPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGFSLPHAILRLDLAGRDLTDYLMKILTERG 199


>At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493
           Actin 3 {Arabidopsis thaliana}; supported by full-length
           cDNA: Ceres: 19581.
          Length = 377

 Score =  181 bits (441), Expect = 3e-46
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNAPAMYVAIQAVLSLYASGRTTGI 153



 Score =  121 bits (292), Expect = 4e-28
 Identities = 56/68 (82%), Positives = 60/68 (88%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 45/46 (97%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERG 199


>At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671
           Actin 1 (Actin 3) {Arabidopsis thaliana}
          Length = 377

 Score =  181 bits (441), Expect = 3e-46
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNAPAMYVAIQAVLSLYASGRTTGI 153



 Score =  121 bits (292), Expect = 4e-28
 Identities = 56/68 (82%), Positives = 60/68 (88%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           E++  LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSKR
Sbjct: 5   EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKR 64

Query: 244 GILTSNTP 267
           GILT   P
Sbjct: 65  GILTLKYP 72



 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 45/46 (97%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERG
Sbjct: 154 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERG 199


>At2g42100.1 68415.m05205 actin, putative very strong similarity to
           SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493
           Actin 3 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 378

 Score =  166 bits (404), Expect = 1e-41
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHG+V+NWDDMEKIWHHTFYNELR+ PEEHP+LLTEAPLNPK NREKMTQIMFE+
Sbjct: 70  LKYPIEHGVVSNWDDMEKIWHHTFYNELRLEPEEHPILLTEAPLNPKVNREKMTQIMFES 129

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  P+MY+ IQAVLSLY+SGRTTG+
Sbjct: 130 FAFPSMYIGIQAVLSLYSSGRTTGI 154



 Score =  111 bits (268), Expect = 3e-25
 Identities = 49/68 (72%), Positives = 60/68 (88%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 243
           +E  A+V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH+GVMVGM +KD++VGDEAQ++R
Sbjct: 6   DESVAIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHRGVMVGMDEKDTFVGDEAQARR 65

Query: 244 GILTSNTP 267
           GIL+   P
Sbjct: 66  GILSLKYP 73



 Score = 92.3 bits (219), Expect = 3e-19
 Identities = 42/46 (91%), Positives = 44/46 (95%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT+YL KI+ ERG
Sbjct: 155 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTEYLTKIMMERG 200


>At2g42170.1 68415.m05219 actin, putative similar to actin 2
           [Arabidopsis thaliana] gi|9293903|dbj|BAB01806
          Length = 329

 Score =  160 bits (388), Expect = 9e-40
 Identities = 69/84 (82%), Positives = 79/84 (94%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L YP+EHG+V+NWDDMEKIW+HTFY+ELRVAPEEHPVLLTEAPLNPKA+REKMTQIMFET
Sbjct: 24  LDYPMEHGVVSNWDDMEKIWYHTFYSELRVAPEEHPVLLTEAPLNPKADREKMTQIMFET 83

Query: 435 FNTPAMYVAIQAVLSLYASGRTTG 506
           F  P+MY+ +QA LSL+ASGRTTG
Sbjct: 84  FAVPSMYIGMQAALSLHASGRTTG 107



 Score = 83.4 bits (197), Expect = 1e-16
 Identities = 40/49 (81%), Positives = 43/49 (87%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRS 655
           VLDSGDGVS+ VPIYEG ALPHAILRLDLAGR LT+YLMKI+ ERG  S
Sbjct: 109 VLDSGDGVSYIVPIYEGSALPHAILRLDLAGRHLTNYLMKIMMERGYTS 157



 Score = 35.5 bits (78), Expect = 0.032
 Identities = 14/27 (51%), Positives = 21/27 (77%)
 Frame = +1

Query: 187 MVGMGQKDSYVGDEAQSKRGILTSNTP 267
           MVGM + D +VGD+A+++ GILT + P
Sbjct: 1   MVGMNENDLFVGDDAEARSGILTLDYP 27


>At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin
           11 {Arabidopsis thaliana}; contains Pfam profile
           PF00022: Actin
          Length = 366

 Score =  159 bits (386), Expect = 2e-39
 Identities = 75/108 (69%), Positives = 86/108 (79%)
 Frame = +3

Query: 186 DGRHGTERLVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 365
           DG +  E  V    G   +    LK P+EHGIV NWDDMEKIWH+TFYNELRV PEEHPV
Sbjct: 36  DGLNPNESYVGEE-GHANRDILTLKDPMEHGIVNNWDDMEKIWHYTFYNELRVDPEEHPV 94

Query: 366 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           LLTEAP NPKANREKMTQIMFE+F+ PAMYV++Q+VL LY+SGRTTG+
Sbjct: 95  LLTEAPYNPKANREKMTQIMFESFDVPAMYVSMQSVLYLYSSGRTTGV 142



 Score = 84.6 bits (200), Expect = 5e-17
 Identities = 37/46 (80%), Positives = 42/46 (91%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLD G+ VSHTVP+YEGYALPH ILRLDL GRDLTDYL++I+TERG
Sbjct: 143 VLDLGERVSHTVPVYEGYALPHGILRLDLGGRDLTDYLIEIMTERG 188



 Score = 68.1 bits (159), Expect = 5e-12
 Identities = 32/63 (50%), Positives = 41/63 (65%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V D G GM +AGFAGD+AP+ VFP +VGRPR      G+   +SYVG+E  + R ILT 
Sbjct: 4   IVCDKGHGMVQAGFAGDEAPKVVFPCVVGRPRD-----GLNPNESYVGEEGHANRDILTL 58

Query: 259 NTP 267
             P
Sbjct: 59  KDP 61


>At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly
           identical to actin-related protein 2 (ARP2) [Arabidopsis
           thaliana] GI:3818624; contains Pfam profile PF00022:
           Actin
          Length = 389

 Score =  117 bits (282), Expect = 6e-27
 Identities = 48/93 (51%), Positives = 66/93 (70%)
 Frame = +3

Query: 231 TEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 410
           +E +   D+ YP+ +GIV NWDDME +W H FYNEL++ P +  +LLT+ PLNP  NREK
Sbjct: 60  SELRHQLDINYPVHNGIVQNWDDMEHVWDHAFYNELKINPSDCKILLTDPPLNPSKNREK 119

Query: 411 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           M + MFE +N   +++ IQAVL+LYA G  TG+
Sbjct: 120 MIETMFEKYNFAGVFIQIQAVLTLYAQGLLTGL 152



 Score = 62.1 bits (144), Expect = 3e-10
 Identities = 24/46 (52%), Positives = 36/46 (78%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H VP+ +GY+ PH   R+++AGR +T YL+ +L+ RG
Sbjct: 153 VIDSGDGVTHVVPVVDGYSFPHLTKRMNVAGRHITAYLVDLLSRRG 198



 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 27/65 (41%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 252
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  ++    KD  VG+     R  L
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLMEQQVKDIVVGETCSELRHQL 66

Query: 253 TSNTP 267
             N P
Sbjct: 67  DINYP 71


>At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical
           to actin-related protein 3 (ARP3) [Arabidopsis thaliana]
           GI:21427461; contains Pfam profile PF00022: Actin
          Length = 427

 Score =  101 bits (243), Expect = 3e-22
 Identities = 49/105 (46%), Positives = 66/105 (62%)
 Frame = +3

Query: 198 GTERLVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 377
           G E L + R  +      +L YPIEHG V +WD ME+ W    +N LR  PE+H  LLTE
Sbjct: 71  GDEALAKSRSSSTH----NLHYPIEHGQVEDWDAMERYWQQCIFNYLRCDPEDHYFLLTE 126

Query: 378 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGMC 512
           +PL P  +RE   +I+FETFN P +Y+A+ +VL+L A+G TT  C
Sbjct: 127 SPLTPPESREYTGEILFETFNVPGLYIAVNSVLAL-AAGYTTSKC 170



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSLP 661
           V+D GDG +H VP+ EGY +   I  + +AG+D+T ++ +++ ERG    P
Sbjct: 176 VVDVGDGATHVVPVAEGYVIGSCIKSIPIAGKDVTLFIQQLMRERGENIPP 226



 Score = 35.9 bits (79), Expect = 0.024
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 162
           A+V+DNG+G  K GFAG+  P  + P++V
Sbjct: 8   AIVIDNGTGYTKMGFAGNVEPCFILPTVV 36


>At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary
           identical to actin-related protein 4 (ARP4) [Arabidopsis
           thaliana] GI:21427463; contains Pfam profile PF00022:
           Actin; supporting cDNA gi|21427462|gb|AF507912.1|
          Length = 441

 Score = 89.4 bits (212), Expect = 2e-18
 Identities = 37/82 (45%), Positives = 56/82 (68%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           PI+ GIV++WD ++ IW H F + L + P EHP+LL E PLN +  REK  ++MFE +  
Sbjct: 94  PIKDGIVSDWDLVDNIWEHAFKSCLMIDPTEHPMLLAEPPLNTQQQREKAAELMFEKYKV 153

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PA+++A   VL+ +A+GR T +
Sbjct: 154 PALFMAKNPVLTSFATGRATSL 175



 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 23/34 (67%), Positives = 31/34 (91%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIG 38



 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSLP 661
           V+D G G +   P+++GY L  A++   L G  LTD L+K L  +G +  P
Sbjct: 176 VVDCGGGSTTISPVHDGYVLQKAVVSSPLGGEFLTDCLLKSLESKGIKIRP 226


>At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical
           to actin-related protein 7 (ARP7) [Arabidopsis thaliana]
           GI:21427469; contains Pfam profile PF00022: Actin
          Length = 363

 Score = 74.1 bits (174), Expect = 7e-14
 Identities = 37/82 (45%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           PIE G++ +WD ME +  +  Y  L      E  +L T+    PKA RE++ Q+MFETFN
Sbjct: 57  PIERGLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPKAIREQLVQLMFETFN 116

Query: 441 TPAMYVAIQAVLSLYASGRTTG 506
               Y + QAVLSLYA GR +G
Sbjct: 117 VSGFYASEQAVLSLYAVGRISG 138



 Score = 27.5 bits (58), Expect = 8.4
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGR 168
           ALVVD GS   KAG A  D +P  + PS + R
Sbjct: 3   ALVVDAGSKFLKAGAAIPDQSPAMIIPSQMKR 34


>At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identical
           to actin-related protein 5 (ARP5) GI:21489922 from
           [Arabidopsis thaliana]
          Length = 145

 Score = 62.1 bits (144), Expect = 3e-10
 Identities = 25/49 (51%), Positives = 33/49 (67%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 410
           P + GIVT+WD ++ +W H F N L + P EHP+LL E PLN +  REK
Sbjct: 88  PTKDGIVTDWDMVDNVWDHAFRNCLMIDPTEHPMLLAEPPLNSQQQREK 136



 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV---GMGQKDSYVGDEAQ 234
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS+VG     G+ +       +D+   D+ +
Sbjct: 5   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVGAIDGNGMDIDDAANTTEDAKESDKEK 64

Query: 235 SKRGILTSNTPSN 273
            KR + T +   N
Sbjct: 65  GKRKLYTGSQALN 77


>At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly
           identical to actin-related protein 6 (ARP6) [Arabidopsis
           thaliana] GI:21427467; contains Pfam profile PF00022:
           Actin
          Length = 421

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 28/82 (34%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           ++ PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE 
Sbjct: 61  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFED 120

Query: 435 FNTPAMYVA-IQAVLSLYASGR 497
           F   ++Y+A  Q+++ LY + R
Sbjct: 121 FGFSSLYIAHPQSLVHLYEASR 142



 Score = 48.0 bits (109), Expect = 6e-06
 Identities = 23/74 (31%), Positives = 40/74 (54%)
 Frame = +2

Query: 422 HVRNIQHARHVRRHPSRALAVRVRSYHRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 601
           H +++ H     R P   L+   ++    V+D G   +H VP+   + L HAI R+DL G
Sbjct: 130 HPQSLVHLYEASRQPDSILS---KTQCSLVVDCGFSFTHAVPVLHNFTLNHAIKRIDLGG 186

Query: 602 RDLTDYLMKILTER 643
           +  T+YL ++++ R
Sbjct: 187 KAFTNYLKELVSYR 200



 Score = 32.7 bits (71), Expect = 0.22
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 171
           +V+DNG G+ KAG  G+  P  V P+ + +P
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKP 35


>At3g12380.1 68416.m01543 actin/actin-like family protein similar to
           SP|P53946 Actin-like protein ARP5 {Saccharomyces
           cerevisiae}; contains Pfam profile PF00022: Actin
          Length = 724

 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 31/104 (29%), Positives = 50/104 (48%), Gaps = 1/104 (0%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 440
           P +  +V  ++ ME I  + F       +  +HP+L+TE   NP  +R KM +++FET+ 
Sbjct: 85  PFDSNVVYQFEIMEYILDYAFDRLGANGSGIDHPILITECACNPVQSRSKMAELLFETYG 144

Query: 441 TPAMYVAIQAVLSLYASGRTTGMCWTPATVSPTPYPSTRDTHSL 572
            PA+   + A  S Y   +  G+C     V     P    THS+
Sbjct: 145 VPAVAFGVDAAFS-YKYNQLHGICKKDGIVL---CPGFTTTHSI 184



 Score = 44.0 bits (99), Expect = 9e-05
 Identities = 21/49 (42%), Positives = 31/49 (63%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 225
           +V+DNG+   + G+AG+  PR VF +IV RPRH+      G+  + VGD
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKAT----GETVTIVGD 66



 Score = 29.5 bits (63), Expect = 2.1
 Identities = 13/43 (30%), Positives = 24/43 (55%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILT 637
           VL  G   +H++P  +G  +     R ++ G  +TDYL ++L+
Sbjct: 173 VLCPGFTTTHSIPFVDGEPIYKGSSRTNIGGYHVTDYLKQLLS 215


>At5g56180.2 68418.m07009 actin-related protein, putative (ARP8)
           strong similarity to actin-related protein 8A (ARP8)
           [Arabidopsis thaliana] GI:21427473; contains Pfam
           profile PF00022: Actin; supporting cDNA
           gi|21427470|gb|AF507916.1|
          Length = 387

 Score = 35.5 bits (78), Expect = 0.032
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 10/73 (13%)
 Frame = +3

Query: 321 TFYNELRVAPEEHPVLLTEAPL-------NPKANREKMTQIMFETF---NTPAMYVAIQA 470
           T +  ++V P   P++++  PL       + KA+R ++   +F      N PA+    QA
Sbjct: 182 TIFTRMQVKPSMQPIVVS-LPLCHFDDTESAKASRRQLKTAIFNVLFDMNVPAVCAVNQA 240

Query: 471 VLSLYASGRTTGM 509
           VL+LYA+ RT+G+
Sbjct: 241 VLALYAARRTSGI 253


>At5g56180.1 68418.m07008 actin-related protein, putative (ARP8)
           strong similarity to actin-related protein 8A (ARP8)
           [Arabidopsis thaliana] GI:21427473; contains Pfam
           profile PF00022: Actin; supporting cDNA
           gi|21427470|gb|AF507916.1|
          Length = 471

 Score = 35.5 bits (78), Expect = 0.032
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 10/73 (13%)
 Frame = +3

Query: 321 TFYNELRVAPEEHPVLLTEAPL-------NPKANREKMTQIMFETF---NTPAMYVAIQA 470
           T +  ++V P   P++++  PL       + KA+R ++   +F      N PA+    QA
Sbjct: 182 TIFTRMQVKPSMQPIVVS-LPLCHFDDTESAKASRRQLKTAIFNVLFDMNVPAVCAVNQA 240

Query: 471 VLSLYASGRTTGM 509
           VL+LYA+ RT+G+
Sbjct: 241 VLALYAARRTSGI 253


>At5g01040.1 68418.m00007 laccase family protein / diphenol oxidase
           family protein similar to laccase [Pinus
           taeda][GI:13661201], lac110 laccase, Populus
           trichocarpa, EMBL:PTY13773
          Length = 584

 Score = 33.9 bits (74), Expect = 0.096
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = -3

Query: 200 PMPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSS 63
           P P I P  RGL   +G T+  +SSPA+P + +P  +ST +  TS+
Sbjct: 290 PTPDIKP-TRGLIVYQGATS--SSSPAEPLMPVPNDMSTAHRFTSN 332


>At1g16690.2 68414.m01999 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 19/59 (32%), Positives = 26/59 (44%)
 Frame = +3

Query: 234 EQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 410
           E  +Y  +KY + H I + W +  +IW       L+  P   PV  T  P N    REK
Sbjct: 173 EALKYLSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPP---PVNDTN-PYNVFRPREK 227


>At1g16690.1 68414.m01998 transcription factor-related similar to
           enhancer of polycomb (GI:11907923)[Homo sapiens]
          Length = 439

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 19/59 (32%), Positives = 26/59 (44%)
 Frame = +3

Query: 234 EQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 410
           E  +Y  +KY + H I + W +  +IW       L+  P   PV  T  P N    REK
Sbjct: 173 EALKYLSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPP---PVNDTN-PYNVFRPREK 227


>At3g07870.1 68416.m00962 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 417

 Score = 26.2 bits (55), Expect(2) = 2.0
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%)
 Frame = -3

Query: 176 WRGLPTIEGNTARGASSPAKPA--LHIPEPL 90
           WR + T  G  +  +SSP KP   LH   P+
Sbjct: 55  WRSVLTQHGRLSSSSSSPTKPCLLLHCDSPI 85



 Score = 21.8 bits (44), Expect(2) = 2.0
 Identities = 8/27 (29%), Positives = 17/27 (62%)
 Frame = -3

Query: 365 DGMFLGGDTELIVEGMMPNLLHVIPVS 285
           DG+ +GG  E + E ++ ++   +P+S
Sbjct: 17  DGVGVGGGLESLPEDIIADIFSRLPIS 43


>At5g29020.1 68418.m03592 hypothetical protein
          Length = 847

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +1

Query: 454 TSPSKPCSRCTRPVVPPV-CAGLRRRCLPHRTHLRGIRTPSRHPASGL 594
           ++P+KPC   T PV PP    G R+R  P +   RG+ +P+    SG+
Sbjct: 26  SNPAKPCGSRTLPVNPPYPTTGKRKRADPPKPS-RGL-SPNPTDPSGV 71


>At2g33460.1 68415.m04101 p21-rho-binding domain-containing protein
           contains Pfam PF00786: P21-Rho-binding domain
          Length = 224

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 24/82 (29%), Positives = 34/82 (41%), Gaps = 5/82 (6%)
 Frame = +1

Query: 124 GDDAPRAVFPSIVG----RPRHQGVMVGMGQKDSYVGDEAQSKRGI-LTSNTPSNTESSL 288
           G D P    PS +     +   +G +V  G  + Y   +  ++RG  L    PSNT    
Sbjct: 42  GSDGPTNTTPSWMNDFKTQEHEKGQVVSRGNSNKY-NPQGTNQRGAGLKELLPSNTNEKP 100

Query: 289 TGMTWRRFGIIPSTMSSVSPPR 354
              T R+ G   S   + SPPR
Sbjct: 101 KQKTRRKPGGAASPNHNGSPPR 122


>At5g06610.1 68418.m00747 expressed protein contains Pfam profile
           PF04788: Protein of unknown function (DUF620)
          Length = 368

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 12/41 (29%), Positives = 23/41 (56%)
 Frame = -3

Query: 176 WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSHI 54
           WR  P +  + A+GA  P + AL   +PL+ ++  +S+  +
Sbjct: 167 WRYTPWLGDHAAKGAIRPLRRALQGLDPLTISSVFSSAQFV 207


>At4g01535.1 68417.m00199 hypothetical protein
          Length = 137

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +3

Query: 12 LRTCHLFNNTILIQDVRRGSCRVGSRQWL 98
          + + +L  NT +++D  + +C  GS+ WL
Sbjct: 13 IESLNLLKNTTVLEDQGKWNCEFGSKLWL 41


>At3g27530.1 68416.m03441 vesicle tethering family protein contains
           Pfam PF04869: Uso1 / p115 like vesicle tethering
           protein, head region and PF04871: Uso1 / p115 like
           vesicle tethering protein, C terminal region
          Length = 914

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 11/36 (30%), Positives = 18/36 (50%)
 Frame = +3

Query: 453 YVAIQAVLSLYASGRTTGMCWTPATVSPTPYPSTRD 560
           +VA   V   +    T G     +T+ P P+P++RD
Sbjct: 390 FVAADYVFKTFCEKNTEGQTMLASTLIPQPHPTSRD 425


>At2g25565.1 68415.m03060 hypothetical protein
          Length = 206

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 491 RSYHRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDY-LMKILTER 643
           + + RYV+D  +G      +Y G  LP + +RL+L     T + L  +L  R
Sbjct: 36  QQFKRYVIDKSNGSITFNGLYPGPPLPISQIRLNLLNYKFTPFHLFPLLDSR 87


>At2g21330.1 68415.m02538 fructose-bisphosphate aldolase, putative
           strong similarity to plastidic fructose-bisphosphate
           aldolase (EC 4.1.2.13) from Nicotiana paniculata
           (NPALDP1) [GI:4827251], Oryza sativa, PIR2:T02057
           [SP|Q40677]
          Length = 399

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 10/27 (37%), Positives = 15/27 (55%)
 Frame = +3

Query: 249 PDLKYPIEHGIVTNWDDMEKIWHHTFY 329
           P++    EHGI   +D  EK+W   F+
Sbjct: 227 PEIMLDGEHGIDRTYDVAEKVWAEVFF 253


>At1g62420.1 68414.m07042 expressed protein contains Pfam profile
           PF04720: Protein of unknown function (DUF506)
          Length = 465

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 14/51 (27%), Positives = 24/51 (47%)
 Frame = +1

Query: 163 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTSNTPSNTESSLTGMTWRRFG 315
           G  R + +   M    ++VGD + SKR ++        ++ L   +W RFG
Sbjct: 84  GEERMRILSATMEVAGTFVGDISSSKRHLMAFLRNKGFDAGLCKSSWERFG 134


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,157,779
Number of Sequences: 28952
Number of extensions: 386737
Number of successful extensions: 1369
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 1258
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1367
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1383534864
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).