SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30036
         (699 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g04840.1 68416.m00525 40S ribosomal protein S3A (RPS3aA) simi...   125   2e-29
At4g34670.1 68417.m04922 40S ribosomal protein S3A (RPS3aB)           124   6e-29
At4g37440.1 68417.m05299 expressed protein                             33   0.18 
At3g17380.1 68416.m02221 meprin and TRAF homology domain-contain...    32   0.42 
At2g46530.1 68415.m05802 transcriptional factor B3 family protei...    31   0.56 
At3g52640.1 68416.m05799 nicastrin-related contains weak similar...    30   1.3  
At1g74390.1 68414.m08618 exonuclease family protein contains exo...    29   3.9  
At5g42470.1 68418.m05170 expressed protein low similarity to BRE...    28   5.2  
At2g17930.1 68415.m02076 FAT domain-containing protein / phospha...    28   6.8  
At4g00890.1 68417.m00120 proline-rich family protein contains pr...    27   9.0  

>At3g04840.1 68416.m00525 40S ribosomal protein S3A (RPS3aA) similar
           to 40S ribosomal protein S3A (S phase specific protein
           GBIS289) GB:P49396 [Brassica rapa]
          Length = 262

 Score =  125 bits (302), Expect = 2e-29
 Identities = 65/102 (63%), Positives = 77/102 (75%), Gaps = 2/102 (1%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           +KG KKK VDPF++KDWYDVKAPS+F+ R VG TLV+RTQGTKIASEGLK RVFEVSLAD
Sbjct: 13  RKGGKKKAVDPFSKKDWYDVKAPSIFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLAD 72

Query: 182 LQADTDAERSFRKFRLIAEYVQGR--MCSATSTAWTSQPISS 301
           LQ D D   ++RK RL AE VQGR  +C      +T+  + S
Sbjct: 73  LQGDED--NAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKLRS 112



 Score =  124 bits (299), Expect = 6e-29
 Identities = 62/122 (50%), Positives = 83/122 (68%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCY 435
           VLC F GMD TTDKLR +VKKWQTLIEA++DVKTTD Y LR+FCI FT + +   ++TCY
Sbjct: 96  VLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCY 155

Query: 436 AQHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEKGLPWHLTLCAMFGIRK 615
           AQ +Q+R IR+KM +I+ R+ ++ D         P++I ++IEK       L  +F IRK
Sbjct: 156 AQSSQIRQIRRKMRDIMVREASSCDLKDLVAKFIPEAIGREIEKATQGIYPLQNVF-IRK 214

Query: 616 *K 621
            K
Sbjct: 215 VK 216


>At4g34670.1 68417.m04922 40S ribosomal protein S3A (RPS3aB)
          Length = 262

 Score =  124 bits (299), Expect = 6e-29
 Identities = 62/122 (50%), Positives = 83/122 (68%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCY 435
           VL  F GMD TTDKLR +VKKWQTLIEA++DVKTTDGY LR+FCI FT + +   ++TCY
Sbjct: 96  VLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRMFCIAFTKRRANQVKRTCY 155

Query: 436 AQHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEKGLPWHLTLCAMFGIRK 615
           AQ +Q+R IR+KM EI+ ++ ++ D         P++I ++IEK       L  +F IRK
Sbjct: 156 AQSSQIRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGREIEKATQGIYPLQNVF-IRK 214

Query: 616 *K 621
            K
Sbjct: 215 VK 216



 Score =  122 bits (293), Expect = 3e-28
 Identities = 61/84 (72%), Positives = 68/84 (80%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           +KG KKK VDPF++KDWYDVKAP  F+ R VG TLV+RTQGTKIASEGLK RVFEVSLAD
Sbjct: 13  RKGGKKKAVDPFSKKDWYDVKAPGSFTNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLAD 72

Query: 182 LQADTDAERSFRKFRLIAEYVQGR 253
           LQ D D   ++RK RL AE VQGR
Sbjct: 73  LQNDED--NAYRKIRLRAEDVQGR 94


>At4g37440.1 68417.m05299 expressed protein
          Length = 471

 Score = 33.1 bits (72), Expect = 0.18
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = +2

Query: 461 SERKCVKSLHATSLTLTQGGGEQVDFL-TPLPRTSRRACHGILPSARCLASESESVEEGP 637
           SE K VKS   +S  ++    E  D L + +  + RR    I+P    + +E  S+EEGP
Sbjct: 349 SEEKPVKSASVSSHHVSPEDDETTDILLSEILASKRREGKSIIPDKNLVKTEQASIEEGP 408


>At3g17380.1 68416.m02221 meprin and TRAF homology domain-containing
           protein / MATH domain-containing protein similar to
           ubiquitin-specific protease 12 [Arabidopsis thaliana]
           GI:11993471; contains Pfam profile PF00917: MATH domain
          Length = 309

 Score = 31.9 bits (69), Expect = 0.42
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = +2

Query: 167 VSLADLQADTDAERSFRKFRL-IAEYVQGRMCSATSTAWTSQPISSGGWLK 316
           ++L D +  +D  + F +F + I + +QGR  +   T W S+  S  GW+K
Sbjct: 224 LTLVDPETISDGTKIFVEFTIRIFDQLQGRHIAGKVTKWFSRSSSEHGWVK 274


>At2g46530.1 68415.m05802 transcriptional factor B3 family protein /
           auxin-responsive factor AUX/IAA-related contains Pfam
           profiles: PF02309 AUX/IAA family, PF02362 B3 DNA binding
           domain
          Length = 601

 Score = 31.5 bits (68), Expect = 0.56
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -1

Query: 333 DESLPFFNHPPELIGCEVHAVEV-AEHIRPCTYSAINLNLRKDLSASVS 190
           D+ +P FN PP+++ C V +V + AEH     Y+ I L   +D S   S
Sbjct: 61  DQEIPVFNLPPKIL-CRVLSVTLKAEHETDEVYAQITLQPEEDQSEPTS 108


>At3g52640.1 68416.m05799 nicastrin-related contains weak similarity
           to Nicastrin precursor (Swiss-Prot:Q92542) [Homo
           sapiens]
          Length = 676

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 3/58 (5%)
 Frame = -1

Query: 486 NDFTH-FLSDCSDLSVLGVARLA--LAQGVLIGETNAEDT*NVSIGCLHINVGFDESL 322
           N F H  L D S+++   V   A  +A+ + I  ++ +DT N ++G +H+N  F E L
Sbjct: 430 NKFYHSHLDDLSNINSSSVVAAASVVARTLYILASDNKDTSNSALGSIHVNASFVEEL 487


>At1g74390.1 68414.m08618 exonuclease family protein contains
           exonuclease domain, Pfam:PF00929
          Length = 506

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = -1

Query: 675 RESSQSTSRSPKTGPSST 622
           RESS S+S SPKT PSS+
Sbjct: 220 RESSTSSSSSPKTDPSSS 237


>At5g42470.1 68418.m05170 expressed protein low similarity to BRE
           alpha b isoform [Homo sapiens] GI:16326573
          Length = 382

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 14/48 (29%), Positives = 23/48 (47%)
 Frame = -1

Query: 318 FFNHPPELIGCEVHAVEVAEHIRPCTYSAINLNLRKDLSASVSACRSA 175
           +  H  E +  ++H    A  +R     A++LNL + L A  + CR A
Sbjct: 247 YLPHLEETLERQIHEAVAAIDLRRSFIEALSLNLGRPLEADPTFCRKA 294


>At2g17930.1 68415.m02076 FAT domain-containing protein /
            phosphatidylinositol 3- and 4-kinase family protein
            contains Pfam profiles PF02259 FAT domain, PF00454
            Phosphatidylinositol 3- and 4-kinase, PF02260: FATC
            domain
          Length = 3795

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 16/49 (32%), Positives = 27/49 (55%)
 Frame = -3

Query: 157  SSLQSFRSNFRSLGTVDKRGADLPLAEHRRSLDIVPIFASEWVDNLLLN 11
            S LQS RS F +L  + K  A +   ++ + L++V +  S+W+    LN
Sbjct: 1576 SWLQSNRSVFDTLVLIWKSPARISRLQNEQELNLVQVKESKWLVKCFLN 1624


>At4g00890.1 68417.m00120 proline-rich family protein contains
           proline-rich extensin domains, INTERPRO:IPR002965
          Length = 431

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 18/62 (29%), Positives = 26/62 (41%)
 Frame = -1

Query: 699 PPCLHRLRRESSQSTSRSPKTGPSSTLSLSDAKHRAEGKMPWQALLDVLGNGVRKSTCSP 520
           PP L     E+ QS S  P   P++ +SLS  K          A      + + ++T SP
Sbjct: 267 PPLLSPKASENHQSKSPMPPPSPTAQISLSSLKSPIPSPATITAPPPPFSSPLSQTTPSP 326

Query: 519 PP 514
            P
Sbjct: 327 KP 328


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,134,813
Number of Sequences: 28952
Number of extensions: 353579
Number of successful extensions: 1077
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1036
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1075
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1496852856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).