SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30031
         (567 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g14070.1 68417.m02172 AMP-binding protein, putative similar t...    29   2.2  
At1g13210.1 68414.m01532 haloacid dehalogenase-like hydrolase fa...    28   5.0  
At5g63450.1 68418.m07965 cytochrome P450, putative                     27   8.7  

>At4g14070.1 68417.m02172 AMP-binding protein, putative similar to
           AMP-binding protein [gi:1617272] from Brassica napus;
           contains Pfam AMP-binding enzyme domain PF00501;
           identical to cDNA acyl-CoA synthetase-like protein
           GI:20799730
          Length = 727

 Score = 29.1 bits (62), Expect = 2.2
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 5/39 (12%)
 Frame = +2

Query: 305 HPKYAFEYKIEDPHTGDL-----KSQHETRDGDVVKGYY 406
           HP +  E+KI DP T ++     K   + R   V+KGYY
Sbjct: 520 HPMHGTEFKIVDPETNNVLPPGSKGIIKVRGPQVMKGYY 558


>At1g13210.1 68414.m01532 haloacid dehalogenase-like hydrolase
           family protein similar to Potential
           phospholipid-transporting ATPase (EC 3.6.3.1)
           (Chromaffin granule ATPase) from {Homo sapiens}
           SP|Q9Y2Q0, {Mus musculus} SP|P98200, {Bos taurus}
           SP|Q29449; contains InterPro accession IPR005834:
           Haloacid dehalogenase-like hydrolase; ESTs gb|T45045 and
           gb|AA394473 come from this gene
          Length = 1203

 Score = 27.9 bits (59), Expect = 5.0
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = -2

Query: 263 LARFMVMHEHGCSVYSRSSMMRCYWY 186
           L R +++H H C  YSR S M CY++
Sbjct: 905 LERLLLVHGHWC--YSRISSMICYFF 928


>At5g63450.1 68418.m07965 cytochrome P450, putative
          Length = 510

 Score = 27.1 bits (57), Expect = 8.7
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -3

Query: 460 LLGGVFHNTDRSISFMQRVVALHDITVASL 371
           LLGG   N+D  +   QR +A H+ T+ SL
Sbjct: 116 LLGGGIFNSDGELWSSQRKLASHEFTMRSL 145


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,945,611
Number of Sequences: 28952
Number of extensions: 242980
Number of successful extensions: 614
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 592
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 612
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1092379416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).