SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30029
         (530 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g10790.1 68418.m01254 ubiquitin-specific protease 22 (UBP22) ...    28   3.4  
At1g69160.1 68414.m07912 expressed protein                             27   6.0  
At5g19380.1 68418.m02309 expressed protein                             27   7.9  
At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic...    27   7.9  
At4g16960.1 68417.m02558 disease resistance protein (TIR-NBS-LRR...    27   7.9  

>At5g10790.1 68418.m01254 ubiquitin-specific protease 22 (UBP22)
           almost identical to ubiquitin-specific protease 22
           GI:11993484 [Arabidopsis thaliana], one amino acid
           difference
          Length = 557

 Score = 28.3 bits (60), Expect = 3.4
 Identities = 16/51 (31%), Positives = 26/51 (50%)
 Frame = +3

Query: 234 LQSINTHYVAYCTLYPKYLYACIPFLKEFL*RYFLILYTFVHVQLSIGHNL 386
           LQ I+    +YC++Y K LY C+         + L+     H QL+ GH++
Sbjct: 48  LQGIDIPRCSYCSVYQKRLYICLICRSISCSSHILL-----HTQLNKGHDI 93


>At1g69160.1 68414.m07912 expressed protein
          Length = 321

 Score = 27.5 bits (58), Expect = 6.0
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +3

Query: 9   SAPGGKRSKRSNSIQNRVNFYANESVKKTRTKRT 110
           S+PGGK +   NS+ ++     N+S  K++TK T
Sbjct: 117 SSPGGKIASFLNSLFHQAGSKKNKSKSKSKTKPT 150


>At5g19380.1 68418.m02309 expressed protein
          Length = 447

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 260 RLLYAISEIPLRLYPVFKRIFMTVFFNSVHF 352
           R+LY ++ IPL+ YP F     T  + +V+F
Sbjct: 120 RVLYKLALIPLKQYPFFLAQLSTFGYVAVYF 150


>At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical
           to gi_11935088_gb_AAG41964
          Length = 209

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 1/54 (1%)
 Frame = +1

Query: 10  APLAANAANVPTPYKIELTFTLTRALKKLALSALYTGSLA-RVPVLISPGPNNE 168
           AP+AA  A+VP P   +   T  ++ K  A  A     L    P   SPGPN++
Sbjct: 117 APVAAPVADVPAPAPSKHKKTTKKSKKHQAAPAPAPELLGPPAPPTESPGPNSD 170


>At4g16960.1 68417.m02558 disease resistance protein (TIR-NBS-LRR
           class), putative domain signature TIR-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 1041

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 14/40 (35%), Positives = 21/40 (52%)
 Frame = -2

Query: 472 LFKLTNRINLTELLYKVLIFA*RSVGNFYKLWPIDSCTCT 353
           L K TN +NL     K L+    ++GN  KL+ ++   CT
Sbjct: 758 LSKATNLVNLNLSNCKSLVTLPSTIGNHQKLYTLEMKECT 797


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,935,748
Number of Sequences: 28952
Number of extensions: 216743
Number of successful extensions: 450
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 446
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 450
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 987020800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).