SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30027
         (765 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g13920.1 68416.m01758 eukaryotic translation initiation facto...   166   1e-41
At1g72730.1 68414.m08410 eukaryotic translation initiation facto...   165   3e-41
At1g54270.1 68414.m06187 eukaryotic translation initiation facto...   163   1e-40
At3g19760.1 68416.m02501 eukaryotic translation initiation facto...   156   1e-38
At1g51380.1 68414.m05780 eukaryotic translation initiation facto...   111   5e-25
At4g00660.2 68417.m00091 DEAD/DEAH box helicase, putative simila...    89   4e-18
At4g00660.1 68417.m00090 DEAD/DEAH box helicase, putative simila...    89   4e-18
At3g61240.2 68416.m06854 DEAD/DEAH box helicase, putative (RH12)...    82   3e-16
At3g61240.1 68416.m06853 DEAD/DEAH box helicase, putative (RH12)...    82   3e-16
At2g45810.1 68415.m05697 DEAD/DEAH box helicase, putative              77   1e-14
At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative simila...    64   1e-10
At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar...    62   5e-10
At5g11200.1 68418.m01309 DEAD/DEAH box helicase, putative              61   9e-10
At5g11170.2 68418.m01306 DEAD/DEAH box helicase, putative (RH15)...    61   9e-10
At5g11170.1 68418.m01305 DEAD/DEAH box helicase, putative (RH15)...    61   9e-10
At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28)...    60   1e-09
At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s...    60   1e-09
At1g77050.1 68414.m08971 DEAD/DEAH box helicase, putative simila...    60   2e-09
At3g02065.2 68416.m00170 DEAD/DEAH box helicase family protein c...    58   6e-09
At3g02065.1 68416.m00171 DEAD/DEAH box helicase family protein c...    58   6e-09
At3g01540.3 68416.m00084 DEAD box RNA helicase (DRH1) identical ...    57   1e-08
At3g01540.2 68416.m00083 DEAD box RNA helicase (DRH1) identical ...    57   1e-08
At3g01540.1 68416.m00082 DEAD box RNA helicase (DRH1) identical ...    57   1e-08
At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar...    56   2e-08
At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar...    56   3e-08
At2g33730.1 68415.m04134 DEAD box RNA helicase, putative similar...    56   3e-08
At1g55150.1 68414.m06298 DEAD box RNA helicase, putative (RH20) ...    56   3e-08
At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar...    56   3e-08
At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar...    56   3e-08
At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar...    56   3e-08
At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helica...    55   5e-08
At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helica...    55   5e-08
At5g26742.1 68418.m03161 DEAD box RNA helicase (RH3) nearly iden...    55   5e-08
At1g31970.1 68414.m03931 DEAD/DEAH box helicase, putative simila...    55   5e-08
At2g47330.1 68415.m05908 DEAD/DEAH box helicase, putative simila...    54   1e-07
At5g60990.1 68418.m07651 DEAD/DEAH box helicase, putative (RH10)...    54   1e-07
At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ...    53   2e-07
At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ...    53   2e-07
At3g53110.1 68416.m05853 DEAD/DEAH box helicase, putative RNA he...    53   2e-07
At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative simila...    53   2e-07
At4g34910.1 68417.m04950 DEAD/DEAH box helicase, putative (RH16)...    52   6e-07
At4g09730.1 68417.m01598 DEAD/DEAH box helicase, putative RNA he...    51   7e-07
At3g18600.1 68416.m02364 DEAD/DEAH box helicase, putative non-co...    51   1e-06
At1g71370.1 68414.m08239 DEAD/DEAH box helicase, putative simila...    51   1e-06
At5g51280.1 68418.m06357 DEAD-box protein abstrakt, putative           50   2e-06
At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA...    50   2e-06
At3g09720.1 68416.m01151 DEAD/DEAH box helicase, putative simila...    50   2e-06
At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id...    49   4e-06
At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contai...    48   5e-06
At5g54910.1 68418.m06839 DEAD/DEAH box helicase, putative              48   5e-06
At5g05450.1 68418.m00587 DEAD/DEAH box helicase, putative (RH18)       47   2e-05
At2g07750.1 68415.m01003 DEAD box RNA helicase, putative similar...    46   3e-05
At5g63630.1 68418.m07989 DEAD box RNA helicase, putative strong ...    46   4e-05
At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13)...    46   4e-05
At1g71280.1 68414.m08226 DEAD/DEAH box helicase, putative contai...    45   6e-05
At1g63250.1 68414.m07150 DEAD box RNA helicase, putative similar...    45   6e-05
At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong sim...    42   3e-04
At1g12770.1 68414.m01482 DEAD/DEAH box helicase family protein /...    42   3e-04
At5g08620.1 68418.m01025 DEAD box RNA helicase (RH25) identical ...    42   4e-04
At3g06980.1 68416.m00829 DEAD/DEAH box helicase, putative contai...    36   0.022
At5g19210.2 68418.m02287 DEAD/DEAH box helicase, putative EUKARY...    36   0.030
At2g40700.1 68415.m05021 DEAD/DEAH box helicase, putative (RH17)...    36   0.030
At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi...    30   1.5  
At4g14090.1 68417.m02175 UDP-glucoronosyl/UDP-glucosyl transfera...    29   2.6  
At4g14365.1 68417.m02213 zinc finger (C3HC4-type RING finger) fa...    29   3.4  
At2g04620.1 68415.m00470 cation efflux family protein potential ...    29   4.5  
At4g08990.1 68417.m01485 DNA (cytosine-5-)-methyltransferase, pu...    28   5.9  
At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containi...    28   7.8  
At3g47150.1 68416.m05119 F-box family protein various predicted ...    28   7.8  
At2g33170.1 68415.m04064 leucine-rich repeat transmembrane prote...    28   7.8  
At2g30240.1 68415.m03680 cation/hydrogen exchanger, putative (CH...    28   7.8  
At2g15490.2 68415.m01773 UDP-glucoronosyl/UDP-glucosyl transfera...    28   7.8  
At2g15490.1 68415.m01772 UDP-glucoronosyl/UDP-glucosyl transfera...    28   7.8  

>At3g13920.1 68416.m01758 eukaryotic translation initiation factor
           4A-1 / eIF-4A-1 eIF-4A-1 gi:15293046, gi:15450485;
           contains Pfam profile PF00270: DEAD/DEAH box helicase;
           contains Pfam profile PF00271: Helicase conserved
           C-terminal domain
          Length = 412

 Score =  166 bits (404), Expect = 1e-41
 Identities = 97/207 (46%), Positives = 131/207 (63%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF   +LQQ+D S+ +CQAL+LAPTRELAQQI+KV+ ALGD+L  K HAC+GGT+V
Sbjct: 88  GKTATFCSGVLQQLDFSLIQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSV 147

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
           RED R L++GVHVVVGTPGRV+DM+   +     ++ + +  L +    +SR        
Sbjct: 148 REDQRILQAGVHVVVGTPGRVFDML---KRQSLRADNIKMFVLDEADEMLSRGFKDQIYD 204

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNF-TCIELEEW 528
             QL+       +    M  + L+   + +      L +R  L  + +  F   +E EEW
Sbjct: 205 IFQLLPPKIQVGVFSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEW 264

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           KLETLCDLY+TL+I Q+VIF NTRRKV
Sbjct: 265 KLETLCDLYETLAITQSVIFVNTRRKV 291



 Score =  120 bits (288), Expect = 1e-27
 Identities = 55/85 (64%), Positives = 73/85 (85%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R++L A+ IK+FVLDEADEMLSRGFKDQI+D+F++L   +QV + SATMP + LE++R F
Sbjct: 174 RQSLRADNIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKF 233

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH 512
           M  PVRILV+++ELTLEGIKQFY++
Sbjct: 234 MSKPVRILVKRDELTLEGIKQFYVN 258



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLT+ M  RD TVSA HG
Sbjct: 257 VNVEKEEWKLETLCDLYETLAITQSVIFVNTR-RKVDWLTDKMRSRDHTVSATHG 310


>At1g72730.1 68414.m08410 eukaryotic translation initiation factor
           4A, putative / eIF-4A, putative similar to Eukaryotic
           initiation factor 4A-10 GB:P41382 [Nicotiana tabacum];
           identical to (putative) RNA helicase GB:CAA09211
           [Arabidopsis thaliana] (Nucleic Acids Res. 27 (2),
           628-636 (1999))
          Length = 414

 Score =  165 bits (401), Expect = 3e-41
 Identities = 96/207 (46%), Positives = 130/207 (62%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF   +LQQ+D S+ +CQAL+LAPTRELAQQI+KV+ ALGD+L  K  AC+GGT+V
Sbjct: 90  GKTATFCSGVLQQLDISLVQCQALVLAPTRELAQQIEKVMRALGDYLGVKAQACVGGTSV 149

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
           RED R L+SGVHVVVGTPGRV+D++   R     ++ + +  L +    +SR        
Sbjct: 150 REDQRVLQSGVHVVVGTPGRVFDLL---RRQSLRADAIKMFVLDEADEMLSRGFKDQIYD 206

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNF-TCIELEEW 528
             QL+       +    M  + L+   + +      L +R  L  + +  F   ++ EEW
Sbjct: 207 IFQLLPSKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEW 266

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           KLETLCDLY+TL+I Q+VIF NTRRKV
Sbjct: 267 KLETLCDLYETLAITQSVIFVNTRRKV 293



 Score =  121 bits (292), Expect = 5e-28
 Identities = 56/85 (65%), Positives = 74/85 (87%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R++L A+ IK+FVLDEADEMLSRGFKDQI+D+F++L + VQV + SATMP + LE++R F
Sbjct: 176 RQSLRADAIKMFVLDEADEMLSRGFKDQIYDIFQLLPSKVQVGVFSATMPPEALEITRKF 235

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH 512
           M  PVRILV+++ELTLEGIKQFY++
Sbjct: 236 MNKPVRILVKRDELTLEGIKQFYVN 260



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 13/19 (68%), Positives = 14/19 (73%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLT+ M  RD TVSA HG
Sbjct: 294 DWLTDKMRSRDHTVSATHG 312


>At1g54270.1 68414.m06187 eukaryotic translation initiation factor
           4A-2 / eIF-4A-2 similar to eukaryotic translation
           initiation factor 4A GI:19696 from [Nicotiana
           plumbaginifolia]
          Length = 412

 Score =  163 bits (396), Expect = 1e-40
 Identities = 95/207 (45%), Positives = 129/207 (62%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF   +LQQ+D ++ +CQAL+LAPTRELAQQI+KV+ ALGD+   K HAC+GGT+V
Sbjct: 88  GKTATFCSGVLQQLDYALLQCQALVLAPTRELAQQIEKVMRALGDYQGVKVHACVGGTSV 147

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
           RED R L++GVHVVVGTPGRV+DM+      P   + + +  L +    +SR        
Sbjct: 148 REDQRILQAGVHVVVGTPGRVFDMLRRQSLRP---DCIKMFVLDEADEMLSRGFKDQIYD 204

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNF-TCIELEEW 528
             QL+       +    M  + L+   + +      L +R  L  + +  F   +E E+W
Sbjct: 205 IFQLLPPKIQVGVFSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEDW 264

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           KLETLCDLY+TL+I Q+VIF NTRRKV
Sbjct: 265 KLETLCDLYETLAITQSVIFVNTRRKV 291



 Score =  117 bits (282), Expect = 7e-27
 Identities = 54/85 (63%), Positives = 72/85 (84%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R++L  + IK+FVLDEADEMLSRGFKDQI+D+F++L   +QV + SATMP + LE++R F
Sbjct: 174 RQSLRPDCIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKF 233

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH 512
           M  PVRILV+++ELTLEGIKQFY++
Sbjct: 234 MSKPVRILVKRDELTLEGIKQFYVN 258



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLT+ M  RD TVSA HG
Sbjct: 257 VNVEKEDWKLETLCDLYETLAITQSVIFVNTR-RKVDWLTDKMRSRDHTVSATHG 310


>At3g19760.1 68416.m02501 eukaryotic translation initiation factor
           4A, putative / eIF-4A, putative / DEAD box RNA helicase,
           putative contains DEAD/DEAH helicase domain; similar to
           RNA helicase GB:CAA09195 from [Arabidopsis thaliana];
           identical to cDNA DEAD box RNA helicase, RH2 GI:3775984
          Length = 408

 Score =  156 bits (379), Expect = 1e-38
 Identities = 97/214 (45%), Positives = 125/214 (58%), Gaps = 11/214 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT+  ++S+ Q +DTS RE QALIL+PTRELA Q +K + A+G H N + HACIGG +V
Sbjct: 84  GKTSMIALSVCQVVDTSSREVQALILSPTRELATQTEKTIQAIGLHANIQAHACIGGNSV 143

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+LE GVHVV GTPGRV DMI   R + T +  L ++           +  M+S  
Sbjct: 144 GEDIRKLEHGVHVVSGTPGRVCDMI-KRRSLRTRAIKLLIL---------DESDEMLSRG 193

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL----------YAYLYRRKSLPWKVLNN-FT 507
           F   ++  Y  L P L +         EIL             L +R  L  + +   F 
Sbjct: 194 FKDQIYDVYRYLPPDLQVCLVSATLPHEILEMTSKFMTEPVKILVKRDELTLEGIKQFFV 253

Query: 508 CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
            +E EEWK +TLCDLYDTL+I QAVIFCNT+RKV
Sbjct: 254 AVEKEEWKFDTLCDLYDTLTITQAVIFCNTKRKV 287



 Score =  115 bits (277), Expect = 3e-26
 Identities = 71/173 (41%), Positives = 105/173 (60%), Gaps = 4/173 (2%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR+L    IKL +LDE+DEMLSRGFKDQI+DV++ L  D+QV L+SAT+P ++LE++  F
Sbjct: 170 RRSLRTRAIKLLILDESDEMLSRGFKDQIYDVYRYLPPDLQVCLVSATLPHEILEMTSKF 229

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTS----CNFLQHPSQ 605
           M +PV+ILV+++ELTLEGIKQF++   +     +++  +  T+  T     CN  +    
Sbjct: 230 MTEPVKILVKRDELTLEGIKQFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNTKRKVDY 289

Query: 606 GGIGSLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                 +    V+ ++    GDM Q+E + IM         V   TTD+WARG
Sbjct: 290 LSEKMRSHNFTVSSMH----GDMPQKERDAIMNEFRSGDSRVL-ITTDVWARG 337



 Score = 28.7 bits (61), Expect = 4.5
 Identities = 11/19 (57%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           D+L+E M   +FTVS+MHG
Sbjct: 288 DYLSEKMRSHNFTVSSMHG 306


>At1g51380.1 68414.m05780 eukaryotic translation initiation factor
           4A, putative / eIF-4A, putative
          Length = 392

 Score =  111 bits (267), Expect = 5e-25
 Identities = 50/84 (59%), Positives = 68/84 (80%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R +L    +KL VLDE+DEMLS+G KDQI+DV++ L  D+QV L+SAT+P ++LE++  F
Sbjct: 157 RGSLQTKAVKLLVLDESDEMLSKGLKDQIYDVYRALPHDIQVCLISATLPQEILEMTEKF 216

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
           M DPVRILV+ +ELTLEGIKQ+Y+
Sbjct: 217 MTDPVRILVKPDELTLEGIKQYYV 240



 Score =  106 bits (255), Expect = 1e-23
 Identities = 47/85 (55%), Positives = 64/85 (75%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT+  +IS+ Q ++ S R+ Q L+L+P+RELA Q +K + A+G H N + HACIGG ++
Sbjct: 71  GKTSMIAISVCQIVNISSRKVQVLVLSPSRELASQTEKTIQAIGAHTNIQAHACIGGKSI 130

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
            EDI++LE GVH V GTPGRVYDMI
Sbjct: 131 GEDIKKLERGVHAVSGTPGRVYDMI 155



 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 22/33 (66%), Positives = 28/33 (84%)
 Frame = +1

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           ++ EEWK +TLCDLY  L+I QA+IFCNTR+KV
Sbjct: 242 VDKEEWKFDTLCDLYGRLTINQAIIFCNTRQKV 274



 Score = 31.1 bits (67), Expect = 0.84
 Identities = 12/19 (63%), Positives = 14/19 (73%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE M   +F VS+MHG
Sbjct: 275 DWLTEKMRSSNFIVSSMHG 293


>At4g00660.2 68417.m00091 DEAD/DEAH box helicase, putative similar
           to ATP-dependent RNA helicases
          Length = 505

 Score = 88.6 bits (210), Expect = 4e-18
 Identities = 67/210 (31%), Positives = 100/210 (47%), Gaps = 5/210 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F I +L++ID      QA+I+ PTRELA Q  +V   LG HL  +     GGT++
Sbjct: 180 GKTAAFCIPVLEKIDQDNNVIQAVIIVPTRELALQTSQVCKELGKHLKIQVMVTTGGTSL 239

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCC-----PEVSRTRS 345
           ++DI +L   VH++VGTPGR+ D+      +    + L + +  K       P V    S
Sbjct: 240 KDDIMRLYQPVHLLVGTPGRILDLTKKGVCVLKDCSVLVMDEADKLLSQEFQPSVEHLIS 299

Query: 346 MMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELEE 525
            +      LMF + +   P  +  +K  D      Y  +     L  K +  F     E 
Sbjct: 300 FLPESRQILMFSATF---PVTVKDFK--DRFLTNPYV-INLMDELTLKGITQFYAFVEER 353

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
            K+  L  L+  L I Q++IFCN+  +V L
Sbjct: 354 QKIHCLNTLFSKLQINQSIIFCNSVNRVEL 383



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 26/73 (35%), Positives = 44/73 (60%)
 Frame = +3

Query: 288 LFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQ 467
           + V+DEAD++LS+ F+  +  +   L    Q+++ SAT P  V +    F+ +P  ++  
Sbjct: 276 VLVMDEADKLLSQEFQPSVEHLISFLPESRQILMFSATFPVTVKDFKDRFLTNPY-VINL 334

Query: 468 KEELTLEGIKQFY 506
            +ELTL+GI QFY
Sbjct: 335 MDELTLKGITQFY 347


>At4g00660.1 68417.m00090 DEAD/DEAH box helicase, putative similar
           to ATP-dependent RNA helicases
          Length = 505

 Score = 88.6 bits (210), Expect = 4e-18
 Identities = 67/210 (31%), Positives = 100/210 (47%), Gaps = 5/210 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F I +L++ID      QA+I+ PTRELA Q  +V   LG HL  +     GGT++
Sbjct: 180 GKTAAFCIPVLEKIDQDNNVIQAVIIVPTRELALQTSQVCKELGKHLKIQVMVTTGGTSL 239

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCC-----PEVSRTRS 345
           ++DI +L   VH++VGTPGR+ D+      +    + L + +  K       P V    S
Sbjct: 240 KDDIMRLYQPVHLLVGTPGRILDLTKKGVCVLKDCSVLVMDEADKLLSQEFQPSVEHLIS 299

Query: 346 MMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELEE 525
            +      LMF + +   P  +  +K  D      Y  +     L  K +  F     E 
Sbjct: 300 FLPESRQILMFSATF---PVTVKDFK--DRFLTNPYV-INLMDELTLKGITQFYAFVEER 353

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
            K+  L  L+  L I Q++IFCN+  +V L
Sbjct: 354 QKIHCLNTLFSKLQINQSIIFCNSVNRVEL 383



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 26/73 (35%), Positives = 44/73 (60%)
 Frame = +3

Query: 288 LFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQ 467
           + V+DEAD++LS+ F+  +  +   L    Q+++ SAT P  V +    F+ +P  ++  
Sbjct: 276 VLVMDEADKLLSQEFQPSVEHLISFLPESRQILMFSATFPVTVKDFKDRFLTNPY-VINL 334

Query: 468 KEELTLEGIKQFY 506
            +ELTL+GI QFY
Sbjct: 335 MDELTLKGITQFY 347


>At3g61240.2 68416.m06854 DEAD/DEAH box helicase, putative (RH12)
           identical to cDNA DEAD box RNA helicase, RH12 GI:3776000
          Length = 498

 Score = 82.2 bits (194), Expect = 3e-16
 Identities = 63/215 (29%), Positives = 100/215 (46%), Gaps = 10/215 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F I +L++ID +    QA+IL PTRELA Q  +V   L  +LN +     GGT++
Sbjct: 173 GKTGAFCIPVLEKIDPNNNVIQAMILVPTRELALQTSQVCKELSKYLNIQVMVTTGGTSL 232

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
           R+DI +L   VH++VGTPGR+ D+        T      +  L  C   V      + S 
Sbjct: 233 RDDIMRLHQPVHLLVGTPGRILDL--------TKKG---VCVLKDCAMLVMDEADKLLSA 281

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKV--LNNFTCIELEEW-- 528
             Q   +     LP    +  +       + A+  R    P+ +  ++  T + + ++  
Sbjct: 282 EFQPSLEELIQFLPQNRQFLMFSATFPVTVKAFKDRHLRKPYVINLMDQLTLMGVTQYYA 341

Query: 529 ------KLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
                 K+  L  L+  L I Q++IFCN+  +V L
Sbjct: 342 FVEERQKVHCLNTLFSKLQINQSIIFCNSVNRVEL 376



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/73 (31%), Positives = 42/73 (57%)
 Frame = +3

Query: 288 LFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQ 467
           + V+DEAD++LS  F+  + ++ + L  + Q ++ SAT P  V       +R P  ++  
Sbjct: 269 MLVMDEADKLLSAEFQPSLEELIQFLPQNRQFLMFSATFPVTVKAFKDRHLRKPY-VINL 327

Query: 468 KEELTLEGIKQFY 506
            ++LTL G+ Q+Y
Sbjct: 328 MDQLTLMGVTQYY 340


>At3g61240.1 68416.m06853 DEAD/DEAH box helicase, putative (RH12)
           identical to cDNA DEAD box RNA helicase, RH12 GI:3776000
          Length = 498

 Score = 82.2 bits (194), Expect = 3e-16
 Identities = 63/215 (29%), Positives = 100/215 (46%), Gaps = 10/215 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F I +L++ID +    QA+IL PTRELA Q  +V   L  +LN +     GGT++
Sbjct: 173 GKTGAFCIPVLEKIDPNNNVIQAMILVPTRELALQTSQVCKELSKYLNIQVMVTTGGTSL 232

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
           R+DI +L   VH++VGTPGR+ D+        T      +  L  C   V      + S 
Sbjct: 233 RDDIMRLHQPVHLLVGTPGRILDL--------TKKG---VCVLKDCAMLVMDEADKLLSA 281

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKV--LNNFTCIELEEW-- 528
             Q   +     LP    +  +       + A+  R    P+ +  ++  T + + ++  
Sbjct: 282 EFQPSLEELIQFLPQNRQFLMFSATFPVTVKAFKDRHLRKPYVINLMDQLTLMGVTQYYA 341

Query: 529 ------KLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
                 K+  L  L+  L I Q++IFCN+  +V L
Sbjct: 342 FVEERQKVHCLNTLFSKLQINQSIIFCNSVNRVEL 376



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/73 (31%), Positives = 42/73 (57%)
 Frame = +3

Query: 288 LFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQ 467
           + V+DEAD++LS  F+  + ++ + L  + Q ++ SAT P  V       +R P  ++  
Sbjct: 269 MLVMDEADKLLSAEFQPSLEELIQFLPQNRQFLMFSATFPVTVKAFKDRHLRKPY-VINL 327

Query: 468 KEELTLEGIKQFY 506
            ++LTL G+ Q+Y
Sbjct: 328 MDQLTLMGVTQYY 340


>At2g45810.1 68415.m05697 DEAD/DEAH box helicase, putative
          Length = 528

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 63/210 (30%), Positives = 96/210 (45%), Gaps = 5/210 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F I  L++ID      QA+IL PTRELA Q  +V   L  +L  +     GGT++
Sbjct: 203 GKTGAFCIPTLEKIDPENNVIQAVILVPTRELALQTSQVCKELSKYLKIEVMVTTGGTSL 262

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCC-----PEVSRTRS 345
           R+DI +L   VH++VGTPGR+ D+      +      L + +  K       P +     
Sbjct: 263 RDDIMRLYQPVHLLVGTPGRILDLAKKGVCVLKDCAMLVMDEADKLLSVEFQPSIEELIQ 322

Query: 346 MMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELEE 525
            +      LMF + +   P  +  +K  D   +  Y      +     V   +  +E E 
Sbjct: 323 FLPESRQILMFSATF---PVTVKSFK--DRYLKKPYIINLMDQLTLMGVTQYYAFVE-ER 376

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKVGL 615
            K+  L  L+  L I Q++IFCN+  +V L
Sbjct: 377 QKVHCLNTLFSKLQINQSIIFCNSVNRVEL 406



 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 24/73 (32%), Positives = 43/73 (58%)
 Frame = +3

Query: 288 LFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQ 467
           + V+DEAD++LS  F+  I ++ + L    Q+++ SAT P  V      +++ P  I+  
Sbjct: 299 MLVMDEADKLLSVEFQPSIEELIQFLPESRQILMFSATFPVTVKSFKDRYLKKPY-IINL 357

Query: 468 KEELTLEGIKQFY 506
            ++LTL G+ Q+Y
Sbjct: 358 MDQLTLMGVTQYY 370


>At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative similar
           to gb|L13612 DEAD-box protein (dbp45A) from Drosophila
           melanogaster and is a member of PF|00270 DEAD/DEAH box
           helicase family
          Length = 491

 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 32/81 (39%), Positives = 47/81 (58%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F++ IL ++        AL++ PTRELA Q+ +   ALG  LN +C   +GG ++
Sbjct: 107 GKTAAFALPILHRLAEDPYGVFALVVTPTRELAFQLAEQFKALGSCLNLRCSVIVGGMDM 166

Query: 181 REDIRQLESGVHVVVGTPGRV 243
                 L S  H+V+ TPGR+
Sbjct: 167 LTQTMSLVSRPHIVITTPGRI 187



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDV 416
           K  VLDEAD +L  GF+D++  +F+ L    Q +L SATM  ++
Sbjct: 205 KFLVLDEADRVLDVGFQDELRTIFQCLPKSRQTLLFSATMTSNL 248


>At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar to
           RNA helicases GI:3775995, GI:3775987 from [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 616

 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 38/91 (41%), Positives = 51/91 (56%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQI------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT  F I I+ +I          R    L+LAPTRELA+Q++K        L+  C   
Sbjct: 153 GKTLAFGIPIIDKIIKYNAKHGRGRNPLCLVLAPTRELARQVEKEFRESAPSLDTIC--L 210

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            GGT + + +RQL+ GV V VGTPGRV D++
Sbjct: 211 YGGTPIGQQMRQLDYGVDVAVGTPGRVIDLM 241



 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 21/67 (31%), Positives = 41/67 (61%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R AL+ + ++  VLDEAD+ML  GF + +  + + L    Q ++ SATMP  +  +++ +
Sbjct: 243 RGALNLSEVQFVVLDEADQMLQVGFAEDVEIILEKLPEKRQSMMFSATMPSWIRSLTKKY 302

Query: 438 MRDPVRI 458
           + +P+ +
Sbjct: 303 LNNPLTV 309


>At5g11200.1 68418.m01309 DEAD/DEAH box helicase, putative
          Length = 427

 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 37/84 (44%), Positives = 50/84 (59%), Gaps = 3/84 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F +S LQQI+ S  +  AL+L  TRELA QI    +    +L + K     GG N
Sbjct: 95  GKTAVFVLSTLQQIEPSPGQVSALVLCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVN 154

Query: 178 VR--EDIRQLESGVHVVVGTPGRV 243
           ++  +D+ + E   H+VVGTPGRV
Sbjct: 155 IKIHKDLLKNEC-PHIVVGTPGRV 177



 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEML-SRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L    ++ F+LDE D+ML S   +  + ++FK+   D QV++ SAT+  ++  V + FM+
Sbjct: 186 LSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQ 245

Query: 444 DPVRILVQKE-ELTLEGIKQFYM 509
           DP+ I V  E +LTL G+ Q Y+
Sbjct: 246 DPMEIYVDDEAKLTLHGLVQHYI 268


>At5g11170.2 68418.m01306 DEAD/DEAH box helicase, putative (RH15)
           DEAD BOX RNA helicase RH15, Arabidopsis thaliana,
           EMBL:ATH010466
          Length = 344

 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 37/84 (44%), Positives = 50/84 (59%), Gaps = 3/84 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F +S LQQI+ S  +  AL+L  TRELA QI    +    +L + K     GG N
Sbjct: 12  GKTAVFVLSTLQQIEPSPGQVSALVLCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVN 71

Query: 178 VR--EDIRQLESGVHVVVGTPGRV 243
           ++  +D+ + E   H+VVGTPGRV
Sbjct: 72  IKIHKDLLKNEC-PHIVVGTPGRV 94



 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEML-SRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L    ++ F+LDE D+ML S   +  + ++FK+   D QV++ SAT+  ++  V + FM+
Sbjct: 103 LSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQ 162

Query: 444 DPVRILVQKE-ELTLEGIKQFYM 509
           DP+ I V  E +LTL G+ Q Y+
Sbjct: 163 DPMEIYVDDEAKLTLHGLVQHYI 185


>At5g11170.1 68418.m01305 DEAD/DEAH box helicase, putative (RH15)
           DEAD BOX RNA helicase RH15, Arabidopsis thaliana,
           EMBL:ATH010466
          Length = 427

 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 37/84 (44%), Positives = 50/84 (59%), Gaps = 3/84 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F +S LQQI+ S  +  AL+L  TRELA QI    +    +L + K     GG N
Sbjct: 95  GKTAVFVLSTLQQIEPSPGQVSALVLCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVN 154

Query: 178 VR--EDIRQLESGVHVVVGTPGRV 243
           ++  +D+ + E   H+VVGTPGRV
Sbjct: 155 IKIHKDLLKNEC-PHIVVGTPGRV 177



 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEML-SRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L    ++ F+LDE D+ML S   +  + ++FK+   D QV++ SAT+  ++  V + FM+
Sbjct: 186 LSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQ 245

Query: 444 DPVRILVQKE-ELTLEGIKQFYM 509
           DP+ I V  E +LTL G+ Q Y+
Sbjct: 246 DPMEIYVDDEAKLTLHGLVQHYI 268


>At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28)
           identical to cDNA DEAD box RNA helicase, RH28 GI:3776026
          Length = 789

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 34/86 (39%), Positives = 48/86 (55%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F++  L+++      +   + LIL PTRELA QI  ++  L    + KC   +GG
Sbjct: 216 GKTAAFALPTLERLLFRPKRVFATRVLILTPTRELAVQIHSMIQNLAQFTDIKCGLIVGG 275

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            +VRE    L S   +VV TPGR+ D
Sbjct: 276 LSVREQEVVLRSMPDIVVATPGRMID 301



 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 24/86 (27%), Positives = 44/86 (51%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           + + +LDEAD +L  GF  +I ++ ++     Q +L SATM ++V E+ +  +  P+R+ 
Sbjct: 314 LAVLILDEADRLLQTGFATEITELVRLCPKRRQTMLFSATMTEEVKELVKLSLNKPLRLS 373

Query: 462 VQKEELTLEGIKQFYMH*IRRMEAGN 539
                    G+ +  +  IRR    N
Sbjct: 374 ADPSARRPPGLTEEVVR-IRRTREAN 398


>At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9)
           similar to RNA helicases GI:3775995, GI:3775987
           [Arabidopsis thaliana]; contains Pfam profiles PF00270:
           DEAD/DEAH box helicase, PF00271: Helicase conserved
           C-terminal domain
          Length = 610

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 35/91 (38%), Positives = 51/91 (56%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQI------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT  F I I+ +I          +  Q L+LAPTRELA+Q++K        L+  C   
Sbjct: 165 GKTLAFGIPIIDKIIKFNAKHGRGKNPQCLVLAPTRELARQVEKEFRESAPSLDTIC--L 222

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            GGT + + +R+L  G+ V VGTPGR+ D++
Sbjct: 223 YGGTPIGQQMRELNYGIDVAVGTPGRIIDLM 253



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/67 (34%), Positives = 42/67 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R AL+ + ++  VLDEAD+ML  GF + +  + + L A  Q ++ SATMP  +  +++ +
Sbjct: 255 RGALNLSEVQFVVLDEADQMLQVGFAEDVEIILQKLPAKRQSMMFSATMPSWIRSLTKKY 314

Query: 438 MRDPVRI 458
           + +P+ I
Sbjct: 315 LNNPLTI 321


>At1g77050.1 68414.m08971 DEAD/DEAH box helicase, putative similar
           to RNA helicase GI:3776027 from [Arabidopsis thaliana]
          Length = 513

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 29/87 (33%), Positives = 51/87 (58%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE--CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA F I +L+++   + +   +ALIL+PTR+LA+Q  K    LG   + +    +GG 
Sbjct: 77  GKTAAFLIPMLEKLKQHVPQGGVRALILSPTRDLAEQTLKFTKELGKFTDLRVSLLVGGD 136

Query: 175 NVREDIRQLESGVHVVVGTPGRVYDMI 255
           ++ +   +L  G  V++ TPGR+  ++
Sbjct: 137 SMEDQFEELTKGPDVIIATPGRLMHLL 163



 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 23/77 (29%), Positives = 42/77 (54%)
 Frame = +3

Query: 279 TIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           T++  V DEAD +   GF +Q+H +   LS + Q +L SAT+P  + E ++  +R+P  +
Sbjct: 173 TVEYVVFDEADSLFGMGFAEQLHQILTQLSENRQTLLFSATLPSALAEFAKAGLREPQLV 232

Query: 459 LVQKEELTLEGIKQFYM 509
            +  E      +K  ++
Sbjct: 233 RLDVENKISPDLKLSFL 249


>At3g02065.2 68416.m00170 DEAD/DEAH box helicase family protein
           contains Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 505

 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 32/93 (34%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 1   GKTATFSISILQQIDT--------SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKTA+F + I+ +  T          R   A++LAPTREL  Q++     LG  L  K  
Sbjct: 159 GKTASFLVPIISRCTTYHSEHPSDQRRNPLAMVLAPTRELCVQVEDQAKMLGKGLPFKTA 218

Query: 157 ACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
             +GG  +   + +++ GV +++GTPGRV D++
Sbjct: 219 LVVGGDPMSGQLYRIQQGVELIIGTPGRVVDLL 251



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 25/70 (35%), Positives = 42/70 (60%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRC 434
           ++  +  + I  FVLDE D ML RGF+DQ+  +F+ LS   QV+L SAT+  +V +V   
Sbjct: 252 SKHTIELDNIMTFVLDEVDCMLQRGFRDQVMQIFQALS-QPQVLLFSATISREVEKVGGS 310

Query: 435 FMRDPVRILV 464
             ++ + + +
Sbjct: 311 LAKEIILVSI 320


>At3g02065.1 68416.m00171 DEAD/DEAH box helicase family protein
           contains Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 368

 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 32/93 (34%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 1   GKTATFSISILQQIDT--------SIRECQALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKTA+F + I+ +  T          R   A++LAPTREL  Q++     LG  L  K  
Sbjct: 22  GKTASFLVPIISRCTTYHSEHPSDQRRNPLAMVLAPTRELCVQVEDQAKMLGKGLPFKTA 81

Query: 157 ACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
             +GG  +   + +++ GV +++GTPGRV D++
Sbjct: 82  LVVGGDPMSGQLYRIQQGVELIIGTPGRVVDLL 114



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 25/70 (35%), Positives = 42/70 (60%)
 Frame = +3

Query: 255 TRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRC 434
           ++  +  + I  FVLDE D ML RGF+DQ+  +F+ LS   QV+L SAT+  +V +V   
Sbjct: 115 SKHTIELDNIMTFVLDEVDCMLQRGFRDQVMQIFQALS-QPQVLLFSATISREVEKVGGS 173

Query: 435 FMRDPVRILV 464
             ++ + + +
Sbjct: 174 LAKEIILVSI 183


>At3g01540.3 68416.m00084 DEAD box RNA helicase (DRH1) identical to
           RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 619

 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 29/77 (37%), Positives = 41/77 (53%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+L+PTRELA QIQ+  +  G      C    GG      +R LE G  +VV TPGR+ D
Sbjct: 234 LVLSPTRELATQIQEEAVKFGRSSRISCTCLYGGAPKGPQLRDLERGADIVVATPGRLND 293

Query: 250 MILVVRFMPTPSNFLFL 300
           ++ + R      ++L L
Sbjct: 294 ILEMRRISLRQISYLVL 310



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 21/66 (31%), Positives = 35/66 (53%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           R +    I   VLDEAD ML  GF+ QI  + K +    Q ++ +AT P  V +++   +
Sbjct: 298 RRISLRQISYLVLDEADRMLDMGFEPQIRKIVKEIPTKRQTLMYTATWPKGVRKIAADLL 357

Query: 441 RDPVRI 458
            +P ++
Sbjct: 358 VNPAQV 363


>At3g01540.2 68416.m00083 DEAD box RNA helicase (DRH1) identical to
           RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 619

 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 29/77 (37%), Positives = 41/77 (53%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+L+PTRELA QIQ+  +  G      C    GG      +R LE G  +VV TPGR+ D
Sbjct: 234 LVLSPTRELATQIQEEAVKFGRSSRISCTCLYGGAPKGPQLRDLERGADIVVATPGRLND 293

Query: 250 MILVVRFMPTPSNFLFL 300
           ++ + R      ++L L
Sbjct: 294 ILEMRRISLRQISYLVL 310



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 21/66 (31%), Positives = 35/66 (53%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           R +    I   VLDEAD ML  GF+ QI  + K +    Q ++ +AT P  V +++   +
Sbjct: 298 RRISLRQISYLVLDEADRMLDMGFEPQIRKIVKEIPTKRQTLMYTATWPKGVRKIAADLL 357

Query: 441 RDPVRI 458
            +P ++
Sbjct: 358 VNPAQV 363


>At3g01540.1 68416.m00082 DEAD box RNA helicase (DRH1) identical to
           RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 618

 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 29/77 (37%), Positives = 41/77 (53%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+L+PTRELA QIQ+  +  G      C    GG      +R LE G  +VV TPGR+ D
Sbjct: 234 LVLSPTRELATQIQEEAVKFGRSSRISCTCLYGGAPKGPQLRDLERGADIVVATPGRLND 293

Query: 250 MILVVRFMPTPSNFLFL 300
           ++ + R      ++L L
Sbjct: 294 ILEMRRISLRQISYLVL 310



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 21/66 (31%), Positives = 35/66 (53%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           R +    I   VLDEAD ML  GF+ QI  + K +    Q ++ +AT P  V +++   +
Sbjct: 298 RRISLRQISYLVLDEADRMLDMGFEPQIRKIVKEIPTKRQTLMYTATWPKGVRKIAADLL 357

Query: 441 RDPVRI 458
            +P ++
Sbjct: 358 VNPAQV 363


>At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to
           SP|O00571 DEAD-box protein 3 (Helicase-like protein 2)
           {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo
           sapiens] GI:3523150; contains Pfam profiles PF00270:
           DEAD/DEAH box helicase, PF00271: Helicase conserved
           C-terminal domain
          Length = 633

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 30/78 (38%), Positives = 41/78 (52%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           A+IL+PTRELA QI             K     GGT + + +R+LE GV ++V TPGR+ 
Sbjct: 240 AVILSPTRELASQIHDEAKKFSYQTGVKVVVAYGGTPINQQLRELERGVDILVATPGRLN 299

Query: 247 DMILVVRFMPTPSNFLFL 300
           D++   R       FL L
Sbjct: 300 DLLERARVSMQMIRFLAL 317



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 44/185 (23%), Positives = 80/185 (43%), Gaps = 16/185 (8%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADV----QVILLSATMPDDVLEV 425
           R  +    I+   LDEAD ML  GF+ QI  + + +        Q +L SAT P ++  +
Sbjct: 304 RARVSMQMIRFLALDEADRMLDMGFEPQIRKIVEQMDMPPRGVRQTLLFSATFPREIQRL 363

Query: 426 SRCFMRDPV-----------RILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYC 572
           +  F+ + +            ++VQ+ E  L+  K+ ++  +   +  N +         
Sbjct: 364 AADFLANYIFLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQRENGI----QGKQA 419

Query: 573 TSCNFLQHPSQGGIGSLNLCICVTLLYLLCM-GDMDQREPEVIMKAVSYWLLLVS*FTTD 749
            +  F++  ++ G  SL   +C+       + GD  Q+E EV +KA       +    TD
Sbjct: 420 LTLVFVE--TKRGADSLENWLCINGFPATSIHGDRTQQEREVALKAFKSGRTPIL-VATD 476

Query: 750 LWARG 764
           + ARG
Sbjct: 477 VAARG 481


>At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar to
           RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain, PF00397:
           WW domain
          Length = 713

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 28/77 (36%), Positives = 42/77 (54%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+L+PTRELA QIQ   +  G      C    GG      ++++E GV +VV TPGR+ D
Sbjct: 305 LVLSPTRELATQIQVEALKFGKSSKISCACLYGGAPKGPQLKEIERGVDIVVATPGRLND 364

Query: 250 MILVVRFMPTPSNFLFL 300
           ++ + R      ++L L
Sbjct: 365 ILEMKRISLHQVSYLVL 381



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 18/66 (27%), Positives = 36/66 (54%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           + +  + +   VLDEAD ML  GF+ QI  +   +    Q ++ +AT P +V +++   +
Sbjct: 369 KRISLHQVSYLVLDEADRMLDMGFEPQIRKIVNEVPTKRQTLMYTATWPKEVRKIAADLL 428

Query: 441 RDPVRI 458
            +P ++
Sbjct: 429 VNPAQV 434


>At2g33730.1 68415.m04134 DEAD box RNA helicase, putative similar to
           SP|P23394 Pre-mRNA splicing factor RNA helicase PRP28
           {Saccharomyces cerevisiae}; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain
          Length = 733

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 30/93 (32%), Positives = 52/93 (55%), Gaps = 8/93 (8%)
 Frame = +1

Query: 1   GKTATFSISILQQID-----TSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKTA F + +L  I      +   E +   A+++APTRELAQQI++  +    +L  +  
Sbjct: 362 GKTAAFVLPMLAYISRLPPMSEENETEGPYAVVMAPTRELAQQIEEETVKFAHYLGFRVT 421

Query: 157 ACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           + +GG ++ E   ++  G  +V+ TPGR+ D +
Sbjct: 422 SIVGGQSIEEQGLKITQGCEIVIATPGRLIDCL 454



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 17/98 (17%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKIL-SADVQ----------------VI 386
           RR    N     VLDEAD M+  GF+ Q+  V   + S++++                  
Sbjct: 456 RRYAVLNQCNYVVLDEADRMIDMGFEPQVAGVLDAMPSSNLKPENEEEELDEKKIYRTTY 515

Query: 387 LLSATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQ 500
           + SATMP  V  ++R ++R+PV + +     T + I Q
Sbjct: 516 MFSATMPPGVERLARKYLRNPVVVTIGTAGKTTDLISQ 553


>At1g55150.1 68414.m06298 DEAD box RNA helicase, putative (RH20)
           similar to ethylene-responsive RNA helicase GI:5669638
           from [Lycopersicon esculentum]; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain
          Length = 501

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 27/62 (43%), Positives = 35/62 (56%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELA QIQ+     G     K     GG      +R L+ GV +V+ TPGR+ D
Sbjct: 176 LVLAPTRELAVQIQQEASKFGSSSKIKTTCIYGGVPKGPQVRDLQKGVEIVIATPGRLID 235

Query: 250 MI 255
           M+
Sbjct: 236 MM 237



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 23/66 (34%), Positives = 38/66 (57%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +   VLDEAD ML  GF  QI  +   +  D Q +  SAT P +V ++S+ F+ +P +++
Sbjct: 247 VTYLVLDEADRMLDMGFDPQIRKIVSHIRPDRQTLYWSATWPKEVEQLSKKFLYNPYKVI 306

Query: 462 VQKEEL 479
           +   +L
Sbjct: 307 IGSSDL 312


>At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to
           SP|O00571 DEAD-box protein 3 (Helicase-like protein 2)
           {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo
           sapiens] GI:3523150; contains Pfam profiles PF00270:
           DEAD/DEAH box helicase, PF00271: Helicase conserved
           C-terminal domain
          Length = 646

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 28/63 (44%), Positives = 37/63 (58%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           A+IL+PTRELA QI             K     GGT V + IR+LE GV ++V TPGR+ 
Sbjct: 227 AVILSPTRELACQIHDEARKFSYQTGVKVVVAYGGTPVNQQIRELERGVDILVATPGRLN 286

Query: 247 DMI 255
           D++
Sbjct: 287 DLL 289



 Score = 35.5 bits (78), Expect = 0.039
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 4/65 (6%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADV----QVILLSATMPDDVLEVSRCFMRDP 449
           ++   LDEAD ML  GF+ QI  + + +        Q +L SAT P ++  ++  F+ + 
Sbjct: 299 VRFLALDEADRMLDMGFEPQIRKIVQQMDMPPPGVRQTMLFSATFPREIQRLASDFLSNY 358

Query: 450 VRILV 464
           + + V
Sbjct: 359 IFLAV 363


>At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar to
           RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain, PF00397:
           WW domain
          Length = 1088

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 27/62 (43%), Positives = 35/62 (56%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           LILAPTRELA QIQ   +  G      C    GG      +++LE G  +VV TPGR+ D
Sbjct: 511 LILAPTRELATQIQDEALRFGRSSRISCTCLYGGAPKGPQLKELERGADIVVATPGRLND 570

Query: 250 MI 255
           ++
Sbjct: 571 IL 572



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 1/84 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           + L VLDEAD ML  GF+ QI  +   +    Q ++ +AT P +V +++   + +PV++ 
Sbjct: 582 VSLLVLDEADRMLDMGFEPQIRKIVNEIPPRRQTLMYTATWPKEVRKIASDLLVNPVQVN 641

Query: 462 VQK-EELTLEGIKQFYMH*IRRME 530
           + + +EL        Y+  + +ME
Sbjct: 642 IGRVDELAANKAITQYVEVVPQME 665


>At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to
           RNA helicase [Rattus norvegicus] GI:897915; contains
           Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271:
           Helicase conserved C-terminal domain
          Length = 1166

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 33/90 (36%), Positives = 48/90 (53%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI-DTSIRECQ----ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKT  F + +L+ I D    E       L++APTREL QQI   +      L  +C    
Sbjct: 578 GKTLGFVLPMLRHIKDQPPVEAGDGPIGLVMAPTRELVQQIHSDIRKFSKPLGIRCVPVY 637

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG+ V + I +L+ G  +VV TPGR+ D++
Sbjct: 638 GGSGVAQQISELKRGTEIVVCTPGRMIDIL 667



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 24/73 (32%), Positives = 37/73 (50%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +   V+DEAD M   GF+ QI  + + +  + Q +L SAT P  V  ++R  +  PV I 
Sbjct: 680 VTFLVMDEADRMFDMGFEPQITRIIQNIRPERQTVLFSATFPRQVETLARKVLNKPVEIQ 739

Query: 462 VQKEELTLEGIKQ 500
           V    +  + I Q
Sbjct: 740 VGGRSVVNKDITQ 752


>At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helicase,
           putative (RH30) strong similarity to ethylene-responsive
           RNA helicase [Lycopersicon esculentum] GI:5669638;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain
          Length = 591

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 29/78 (37%), Positives = 42/78 (53%), Gaps = 2/78 (2%)
 Frame = +3

Query: 252 DTRRALHANT--IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEV 425
           D     H N   +   VLDEAD ML  GF+ QI  +   +  D Q +L SAT P +V  +
Sbjct: 301 DMLECQHTNLKRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLLWSATWPREVETL 360

Query: 426 SRCFMRDPVRILVQKEEL 479
           +R F+RDP + ++   +L
Sbjct: 361 ARQFLRDPYKAIIGSTDL 378



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 34/90 (37%), Positives = 43/90 (47%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ-----ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKT  + +  L  +    R  Q      LILAPTRELA QIQ+     G     +     
Sbjct: 214 GKTLAYLLPALVHVSAQPRLGQDDGPIVLILAPTRELAVQIQEESRKFGLRSGVRSTCIY 273

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG      IR L  GV +V+ TPGR+ DM+
Sbjct: 274 GGAPKGPQIRDLRRGVEIVIATPGRLIDML 303


>At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helicase,
           putative (RH30) strong similarity to ethylene-responsive
           RNA helicase [Lycopersicon esculentum] GI:5669638;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain
          Length = 484

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 29/78 (37%), Positives = 42/78 (53%), Gaps = 2/78 (2%)
 Frame = +3

Query: 252 DTRRALHANT--IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEV 425
           D     H N   +   VLDEAD ML  GF+ QI  +   +  D Q +L SAT P +V  +
Sbjct: 301 DMLECQHTNLKRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLLWSATWPREVETL 360

Query: 426 SRCFMRDPVRILVQKEEL 479
           +R F+RDP + ++   +L
Sbjct: 361 ARQFLRDPYKAIIGSTDL 378



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 34/90 (37%), Positives = 43/90 (47%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ-----ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKT  + +  L  +    R  Q      LILAPTRELA QIQ+     G     +     
Sbjct: 214 GKTLAYLLPALVHVSAQPRLGQDDGPIVLILAPTRELAVQIQEESRKFGLRSGVRSTCIY 273

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG      IR L  GV +V+ TPGR+ DM+
Sbjct: 274 GGAPKGPQIRDLRRGVEIVIATPGRLIDML 303


>At5g26742.1 68418.m03161 DEAD box RNA helicase (RH3) nearly
           identical to RNA helicase [Arabidopsis thaliana]
           GI:3775987; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain, PF00098: Zinc knuckle
          Length = 747

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 36/95 (37%), Positives = 52/95 (54%), Gaps = 10/95 (10%)
 Frame = +1

Query: 1   GKTATFSISILQQID------TSIREC----QALILAPTRELAQQIQKVVIALGDHLNAK 150
           GKT  F I I++++       T+ R      + L+LAPTRELA+Q++K +     +L+  
Sbjct: 151 GKTLAFGIPIIKRLTEEAGDYTAFRRSGRLPKFLVLAPTRELAKQVEKEIKESAPYLSTV 210

Query: 151 CHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           C    GG +       L  GV VVVGTPGR+ D+I
Sbjct: 211 C--VYGGVSYTIQQSALTRGVDVVVGTPGRIIDLI 243



 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 31/83 (37%), Positives = 52/83 (62%), Gaps = 2/83 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           R+L    ++  VLDEAD+ML+ GF++ +  + + L    Q +L SATMP  V +++R ++
Sbjct: 246 RSLKLGEVEYLVLDEADQMLAVGFEEAVESILENLPTKRQSMLFSATMPTWVKKLARKYL 305

Query: 441 RDPVRI-LV-QKEELTLEGIKQF 503
            +P+ I LV  ++E   EGIK +
Sbjct: 306 DNPLNIDLVGDQDEKLAEGIKLY 328


>At1g31970.1 68414.m03931 DEAD/DEAH box helicase, putative similar
           to p68 RNA helicase [Schizosaccharomyces pombe]
           GI:173419
          Length = 537

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 27/62 (43%), Positives = 38/62 (61%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+L+PTRELA QI  V+   G+    K     GG++    I  + SGV +V+GTPGR+ D
Sbjct: 195 LVLSPTRELAVQISDVLREAGEPCGLKSICVYGGSSKGPQISAIRSGVDIVIGTPGRLRD 254

Query: 250 MI 255
           +I
Sbjct: 255 LI 256



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 22/72 (30%), Positives = 43/72 (59%), Gaps = 1/72 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM-R 443
           L  + +   VLDEAD ML  GF++ +  +    +   Q+++ SAT P DV ++++ FM  
Sbjct: 261 LRLSDVSFVVLDEADRMLDMGFEEPVRFILSNTNKVRQMVMFSATWPLDVHKLAQEFMDP 320

Query: 444 DPVRILVQKEEL 479
           +P+++++   +L
Sbjct: 321 NPIKVIIGSVDL 332


>At2g47330.1 68415.m05908 DEAD/DEAH box helicase, putative similar
           to RNA helicase [Rattus norvegicus] GI:897915; contains
           Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271:
           Helicase conserved C-terminal domain
          Length = 760

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 29/80 (36%), Positives = 43/80 (53%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM 440
           +AL        VLDEAD M   GF+ Q+  +   +  D Q +L SATMP  V +++R  +
Sbjct: 369 KALTMMRASYLVLDEADRMFDLGFEPQVRSIVGQIRPDRQTLLFSATMPWKVEKLAREIL 428

Query: 441 RDPVRILVQKEELTLEGIKQ 500
            DP+R+ V +  +  E I Q
Sbjct: 429 SDPIRVTVGEVGMANEDITQ 448



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 32/105 (30%), Positives = 52/105 (49%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQI--DTSIRECQA---LILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F + ++  I     ++  +    +I APTRELA QI             +  A  
Sbjct: 277 GKTAAFVLPMIVHIMDQPELQRDEGPIGVICAPTRELAHQIFLEAKKFSKAYGLRVSAVY 336

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFL 300
           GG +  E  ++L++G  +VV TPGR+ DM+ +       +++L L
Sbjct: 337 GGMSKHEQFKELKAGCEIVVATPGRLIDMLKMKALTMMRASYLVL 381


>At5g60990.1 68418.m07651 DEAD/DEAH box helicase, putative (RH10)
           probable replication protein A1, Oryza sativa,
           EMBL:AF009179
          Length = 456

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 12/95 (12%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------------ALILAPTRELAQQIQKVVIALGDHLN 144
           GKT  F+I ILQ +   + + +            A +L+PTRELA QI +   ALG  ++
Sbjct: 58  GKTGAFAIPILQALLEYVYDSEPKKGRRPDPAFFACVLSPTRELAIQIAEQFEALGADIS 117

Query: 145 AKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
            +C   +GG +  +    L    HV+V TPGR++D
Sbjct: 118 LRCAVLVGGIDRMQQTIALGKRPHVIVATPGRLWD 152



 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 24/76 (31%), Positives = 45/76 (59%)
 Frame = +3

Query: 279 TIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           ++K  VLDEAD +L+  F+  ++ + + +  + +  L SATM   V ++ R  +R+PV+I
Sbjct: 164 SLKYLVLDEADRLLNEDFEKSLNQILEEIPLERKTFLFSATMTKKVRKLQRACLRNPVKI 223

Query: 459 LVQKEELTLEGIKQFY 506
               +  T++ +KQ Y
Sbjct: 224 EAASKYSTVDTLKQQY 239


>At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11)
           similar to RNA helicase DBY protein [Mus musculus]
           GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like
           protein 2) {Homo sapiens}; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain; identical to cDNA DEAD box
           RNA helicase, RH11 GI:3775998
          Length = 612

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 29/78 (37%), Positives = 40/78 (51%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           A+IL+PTRELA QI             K     GGT + + +R+LE G  ++V TPGR+ 
Sbjct: 232 AVILSPTRELACQIHDEAKKFSYQTGVKVVVAYGGTPIHQQLRELERGCDILVATPGRLN 291

Query: 247 DMILVVRFMPTPSNFLFL 300
           D++   R       FL L
Sbjct: 292 DLLERARVSMQMIRFLAL 309



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 4/73 (5%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADV----QVILLSATMPDDVLEV 425
           R  +    I+   LDEAD ML  GF+ QI  + + +        Q +L SAT P  +  +
Sbjct: 296 RARVSMQMIRFLALDEADRMLDMGFEPQIRKIVEQMDMPPRGVRQTMLFSATFPSQIQRL 355

Query: 426 SRCFMRDPVRILV 464
           +  FM + + + V
Sbjct: 356 AADFMSNYIFLAV 368


>At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11)
           similar to RNA helicase DBY protein [Mus musculus]
           GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like
           protein 2) {Homo sapiens}; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain; identical to cDNA DEAD box
           RNA helicase, RH11 GI:3775998
          Length = 612

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 29/78 (37%), Positives = 40/78 (51%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           A+IL+PTRELA QI             K     GGT + + +R+LE G  ++V TPGR+ 
Sbjct: 232 AVILSPTRELACQIHDEAKKFSYQTGVKVVVAYGGTPIHQQLRELERGCDILVATPGRLN 291

Query: 247 DMILVVRFMPTPSNFLFL 300
           D++   R       FL L
Sbjct: 292 DLLERARVSMQMIRFLAL 309



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 4/73 (5%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADV----QVILLSATMPDDVLEV 425
           R  +    I+   LDEAD ML  GF+ QI  + + +        Q +L SAT P  +  +
Sbjct: 296 RARVSMQMIRFLALDEADRMLDMGFEPQIRKIVEQMDMPPRGVRQTMLFSATFPSQIQRL 355

Query: 426 SRCFMRDPVRILV 464
           +  FM + + + V
Sbjct: 356 AADFMSNYIFLAV 368


>At3g53110.1 68416.m05853 DEAD/DEAH box helicase, putative RNA
           helicase, Mus musculus, PIR:I49731
          Length = 496

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 4/85 (4%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKIL---SADVQVILLSATMPDDVLEVS 428
           + L  N +K+ V DEAD ML+  GF+D    + K +   + + QV+L SAT  + V +  
Sbjct: 232 KRLGLNHLKILVFDEADHMLATDGFRDDSLKIMKDIGRVNPNFQVLLFSATFNETVKDFV 291

Query: 429 RCFMRDPVRILVQKEELTLEGIKQF 503
              ++DP ++ V++E+L L+ +KQ+
Sbjct: 292 ARTVKDPNQLFVKREDLALDSVKQY 316



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 28/81 (34%), Positives = 41/81 (50%), Gaps = 2/81 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT-- 174
           GKT  F + +L ++D ++RE QAL + PTRELA Q  +V+  +G          +  +  
Sbjct: 143 GKTTCFVLGMLSRVDPTLREPQALCICPTRELANQNMEVLQKMGKFTGITAELAVPDSTR 202

Query: 175 NVREDIRQLESGVHVVVGTPG 237
                 R      HVV+GTPG
Sbjct: 203 GAPAATRGAPVSAHVVIGTPG 223


>At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative similar
           to RNA helicase GB:A57514 GI:897915 from [Rattus
           norvegicus]; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain
          Length = 989

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI-DTSIRECQ----ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKT  F + +L+ I D    E       L++APTREL QQI   +      L   C    
Sbjct: 445 GKTLGFVLPMLRHIKDQPPVEAGDGPIGLVMAPTRELVQQIYSDIRKFSKALGIICVPVY 504

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG+ V + I +L+ G  +VV TPGR+ D++
Sbjct: 505 GGSGVAQQISELKRGTEIVVCTPGRMIDIL 534



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 25/73 (34%), Positives = 37/73 (50%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +   V+DEAD M   GF+ QI  + + +  D Q +L SAT P  V  ++R  +  PV I 
Sbjct: 547 VTYLVMDEADRMFDMGFEPQITRIVQNIRPDRQTVLFSATFPRQVETLARKVLNKPVEIQ 606

Query: 462 VQKEELTLEGIKQ 500
           V    +  + I Q
Sbjct: 607 VGGRSVVNKDITQ 619


>At4g34910.1 68417.m04950 DEAD/DEAH box helicase, putative (RH16)
           identical to cDNA DEAD box RNA helicase, RH16 GI:3776006
          Length = 626

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 25/83 (30%), Positives = 48/83 (57%), Gaps = 4/83 (4%)
 Frame = +3

Query: 273 ANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPV 452
           + ++ + VLDEAD +LS G++D +  V  I+    Q +L+SAT   DV ++ +  + +P+
Sbjct: 198 SESLSILVLDEADLLLSYGYEDNLRSVTSIIPRRCQCLLMSATTSSDVEKLKKLILHNPI 257

Query: 453 RILV----QKEELTLEGIKQFYM 509
            + +     KEE     ++QF++
Sbjct: 258 VLTLTEDNDKEEAVPSNVQQFWI 280



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 8/86 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQIDT--SIRECQ----ALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT  + + +LQ++ +  S+ + +    A IL P+REL QQ+   V +L +    +  A 
Sbjct: 95  GKTLAYLLPLLQKLFSADSVSKKKLAPSAFILVPSRELCQQVYTEVSSLIELCRVQLKAV 154

Query: 163 -IGGTNVREDIRQLESGV-HVVVGTP 234
            +  +    D+R   +G+  ++V TP
Sbjct: 155 QLTSSMSASDMRNALAGLPEILVSTP 180


>At4g09730.1 68417.m01598 DEAD/DEAH box helicase, putative RNA
           helicase -Mus musculus,PIR2:I84741
          Length = 621

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 23/70 (32%), Positives = 39/70 (55%)
 Frame = +1

Query: 46  TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVV 225
           T  R  + ++L PTREL++Q+ +V  ++  H   +     GG+ +R     L + + +VV
Sbjct: 185 TKPRRPRTVVLCPTRELSEQVYRVAKSISHHARFRSILVSGGSRIRPQEDSLNNAIDMVV 244

Query: 226 GTPGRVYDMI 255
           GTPGR+   I
Sbjct: 245 GTPGRILQHI 254


>At3g18600.1 68416.m02364 DEAD/DEAH box helicase, putative
           non-consensus acceptor splice site AT at exon 2; similar
           to DEAD box helicase protein GB:NP_006764 from [Homo
           sapiens], contains Pfam profile: PF00270  DEAD/DEAH box
           helicase
          Length = 568

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 26/77 (33%), Positives = 44/77 (57%), Gaps = 2/77 (2%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +K  V+DEAD +L   F++ ++ + KIL    Q  L SAT    V +++R  +  PV + 
Sbjct: 237 LKCLVIDEADRILEENFEEDMNKILKILPKTRQTALFSATQTSKVKDLARVSLTSPVHVD 296

Query: 462 VQ--KEELTLEGIKQFY 506
           V   + ++T EG++Q Y
Sbjct: 297 VDDGRRKVTNEGLEQGY 313



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 23/60 (38%), Positives = 36/60 (60%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           +++ PTRELA Q + V   L  H +      IGG N R + +++ SG ++V+ TPGR+ D
Sbjct: 165 IVICPTRELAIQTKNVAEELLKHHSQTVSMVIGGNNRRSEAQRIASGSNLVIATPGRLLD 224


>At1g71370.1 68414.m08239 DEAD/DEAH box helicase, putative similar
           to ATP-dependent RNA helicase GB:6321111 from (S.
           cerevisiae)
          Length = 558

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 8/99 (8%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSI------RECQALILAPTRELAQQIQKVVIALGDHL-NAKCHA 159
           GKT  F +  ++ I  S        +   +I++PTREL+ QI KV       L N     
Sbjct: 65  GKTLAFLLPFIEIIRRSNSYPPKPHQVMGVIISPTRELSAQIHKVAEPFVSTLPNVNSVL 124

Query: 160 CIGGTNVREDIRQLES-GVHVVVGTPGRVYDMILVVRFM 273
            +GG  V  D+  LE  G ++++GTPGR+ DM+  + F+
Sbjct: 125 LVGGREVEADMNTLEEEGANLLIGTPGRLSDMMKRMEFL 163



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 17/65 (26%), Positives = 36/65 (55%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L    +++ +LDEAD +L  GF+ Q++ +   L    +  L SAT    V ++++  +R+
Sbjct: 163 LDFRNLEILILDEADRLLDMGFQKQVNYIISRLPKQRRTGLFSATQTQAVADLAKAGLRN 222

Query: 447 PVRIL 461
            + ++
Sbjct: 223 AMEVI 227


>At5g51280.1 68418.m06357 DEAD-box protein abstrakt, putative 
          Length = 591

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 6/68 (8%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVV------IALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGT 231
           LI+ P+RELA+Q  +VV      +    +   +   CIGG ++R  +  ++ GVH+VV T
Sbjct: 226 LIVCPSRELARQTYEVVEQFVAPLVEAGYPPLRSLLCIGGIDMRSQLEVVKRGVHIVVAT 285

Query: 232 PGRVYDMI 255
           PGR+ DM+
Sbjct: 286 PGRLKDML 293



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 22/69 (31%), Positives = 37/69 (53%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ +  +  +   LDEAD ++  GF+D I +VF    +  Q +L SATMP  +   +R  
Sbjct: 295 KKKMSLDACRYLTLDEADRLVDLGFEDDIREVFDHFKSQRQTLLFSATMPTKIQIFARSA 354

Query: 438 MRDPVRILV 464
           +  PV + V
Sbjct: 355 LVKPVTVNV 363


>At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA
           helicase DBP2 - Saccharomyces cerevisiae, PID:g5272
          Length = 542

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 25/69 (36%), Positives = 45/69 (65%), Gaps = 6/69 (8%)
 Frame = +1

Query: 67  ALILAPTRELAQQ----IQKVVIALGD--HLNAKCHACIGGTNVREDIRQLESGVHVVVG 228
           AL++ P+RELA+Q    +++ V +L +  +   +   CIGG ++R  +  ++ GVH+VV 
Sbjct: 176 ALVICPSRELAKQTYDVVEQFVASLVEDGYPRLRSLLCIGGVDMRSQLDVVKKGVHIVVA 235

Query: 229 TPGRVYDMI 255
           TPGR+ D++
Sbjct: 236 TPGRLKDIL 244



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 22/69 (31%), Positives = 36/69 (52%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ +  +  +L  LDEAD ++  GF+D I  VF    +  Q +L SATMP  +   +   
Sbjct: 246 KKKMSLDACRLLTLDEADRLVDLGFEDDIRHVFDHFKSQRQTLLFSATMPAKIQIFATSA 305

Query: 438 MRDPVRILV 464
           +  PV + V
Sbjct: 306 LVKPVTVNV 314


>At3g09720.1 68416.m01151 DEAD/DEAH box helicase, putative similar
           to RNA helicase involved in rRNA processing GB:6321267
           from [Saccharomyces cerevisiae]c, ontains DEAD and DEAH
           box domain
          Length = 541

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILS-ADVQVILLSATMPDDVLEVSRCF 437
           + +  + ++  VLDE+D++  +    QI  V K  S   +   L SAT+PD V E++R  
Sbjct: 276 KKIDLSKVEYLVLDESDKLFEQSLLKQIDCVVKACSNPSIIRSLFSATLPDSVEELARSI 335

Query: 438 MRDPVRILVQKEELTLEGIKQ 500
           M D VR+++ ++    E +KQ
Sbjct: 336 MHDAVRVIIGRKNTASETVKQ 356


>At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly
           identical to RNA helicase [Arabidopsis thaliana]
           GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain
          Length = 671

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 27/67 (40%), Positives = 35/67 (52%)
 Frame = +1

Query: 55  RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTP 234
           R    L+L PTRELA+Q+     A G  L        GG +      +L+ GV +VVGTP
Sbjct: 173 RSPSVLVLLPTRELAKQVAADFDAYGGSLGLSSCCLYGGDSYPVQEGKLKRGVDIVVGTP 232

Query: 235 GRVYDMI 255
           GR+ D I
Sbjct: 233 GRIKDHI 239



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 2/64 (3%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKIL--SADVQVILLSATMPDDVLEVSR 431
           R+ L  + ++  VLDEADEML  GF + +  +   +  S  VQ +L SAT+P  V  +S 
Sbjct: 241 RQNLDFSYLQFRVLDEADEMLRMGFVEDVELILGKVEDSTKVQTLLFSATLPSWVKNISN 300

Query: 432 CFMR 443
            F++
Sbjct: 301 RFLK 304


>At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contains
           Pfam profiles  PF00270:DEAD/DEAH box helicase and
           PF00271:  Helicase conserved C-terminal domain;
           identical to cDNA RH27 helicase, partial GI:4033334
          Length = 633

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 26/77 (33%), Positives = 44/77 (57%), Gaps = 2/77 (2%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +K  V+DEAD +L + F++ +  +  +L    Q  L SAT    V +++R  +  PV I 
Sbjct: 302 LKFLVMDEADRILEQNFEEDLKKILNLLPKTRQTSLFSATQSAKVEDLARVSLTSPVYID 361

Query: 462 VQ--KEELTLEGIKQFY 506
           V   ++E+T EG++Q Y
Sbjct: 362 VDEGRKEVTNEGLEQGY 378



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 4/87 (4%)
 Frame = +1

Query: 1   GKTATF---SISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F   ++ +L ++  + R     L++ PTRELA Q   V   L  + +      IG
Sbjct: 203 GKTLAFLIPAVELLYRVKFTPRNGTGVLVICPTRELAIQSYGVAKELLKYHSQTVGKVIG 262

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYD 249
           G   + +   L  GV+++V TPGR+ D
Sbjct: 263 GEKRKTEAEILAKGVNLLVATPGRLLD 289


>At5g54910.1 68418.m06839 DEAD/DEAH box helicase, putative 
          Length = 739

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 24/67 (35%), Positives = 37/67 (55%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +++ +LDEAD +L   FK Q+  +   L    Q +L SAT    V +++R  +RDP  I 
Sbjct: 219 LQILILDEADRVLDSAFKGQLDPIISQLPKHRQTLLFSATQTKKVKDLARLSLRDPEYIS 278

Query: 462 VQKEELT 482
           V  E +T
Sbjct: 279 VHAEAVT 285



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ----ALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F I IL+++       +     +I++PTRELA Q   V+  +G          IG
Sbjct: 120 GKTLAFVIPILEKLHRERWSPEDGVGCIIISPTRELAAQTFGVLNKVGKFHKFSAGLLIG 179

Query: 169 GTNVREDIRQLESGVHVVVGTPGRV 243
           G    +  ++    ++++V  PGR+
Sbjct: 180 GREGVDVEKERVHEMNILVCAPGRL 204


>At5g05450.1 68418.m00587 DEAD/DEAH box helicase, putative (RH18) 
          Length = 593

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 29/93 (31%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSI------RECQALILAPTRELAQQIQKVVIALGDHL-NAKCHA 159
           GKT  F + +++ +  S        +   +I++PTREL+ QI  V       L N     
Sbjct: 65  GKTLAFVVPLVEILRRSTSFPPKPHQVMGVIISPTRELSTQIYNVAQPFVSTLANVNSVL 124

Query: 160 CIGGTNVREDIRQLES-GVHVVVGTPGRVYDMI 255
            +GG  V+ D++ +E  G +V++GTPGR+ D++
Sbjct: 125 LVGGREVKADMKIIEEEGCNVLIGTPGRLSDIM 157



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 22/67 (32%), Positives = 40/67 (59%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L    +++ +LDEAD +L  GF+ Q++ +   L    +  L SAT  + V E+++  +R+
Sbjct: 163 LDFRNLEILILDEADRLLEMGFQRQVNYIISRLPKQRRTGLFSATQTEGVEELAKAGLRN 222

Query: 447 PVRILVQ 467
           PVR+ V+
Sbjct: 223 PVRVEVR 229


>At2g07750.1 68415.m01003 DEAD box RNA helicase, putative similar to
           RNA helicase RH25 [Arabidopsis thaliana] GI:3776023;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain
          Length = 845

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 21/54 (38%), Positives = 33/54 (61%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           +KLF++DEAD +L  GFK  +  +   L    Q +L SAT+P +V  VS+  ++
Sbjct: 532 LKLFIVDEADLLLDLGFKRDVEKIIDCLPRQRQSLLFSATIPKEVRRVSQLVLK 585



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 29/64 (45%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIA-LGDHLNAKCHACIGGTNVREDIRQLES-GVHVVVGTPGRV 243
           LIL PTRELA QI     A L +H        IGGT  R D ++LES    +++ TPGR+
Sbjct: 456 LILCPTRELASQIAAEGKALLKNHDGIGVQTLIGGTRFRLDQQRLESEPCQILIATPGRL 515

Query: 244 YDMI 255
            D I
Sbjct: 516 LDHI 519


>At5g63630.1 68418.m07989 DEAD box RNA helicase, putative strong
           similarity to RNA helicase RH25 [Arabidopsis thaliana]
           GI:3776023; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain; identical to cDNA DEAD box RNA helicase, RH31
           GI:3776030
          Length = 522

 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +K+ VLDEAD +L  GF+  I  +   +  + Q  L SAT+P++V ++    +R     +
Sbjct: 210 VKVLVLDEADHLLDMGFRKDIERIISAVPKERQTFLFSATVPEEVRQICLVALRRDHEFV 269

Query: 462 VQKEELTLEGIKQF-YMH*IRRME 530
               E T+E  +Q   MH I  ++
Sbjct: 270 NCVHEGTIETHQQVRQMHMIASLD 293



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = +1

Query: 67  ALILAPTRELAQQ-IQKVVIALGDHLNAKCHACIGGTNVREDIRQLESG-VHVVVGTPGR 240
           AL++ PTRELA Q   +    L  H +      IGGT +  + +++++    ++V TPGR
Sbjct: 133 ALVICPTRELANQAATEANTLLKYHPSIGVQVVIGGTRLGLEQKRMQTNPCQILVATPGR 192

Query: 241 VYDMI 255
           + D I
Sbjct: 193 LKDHI 197


>At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13)
           similar to RNA helicase GB:CAA09204 from [Arabidopsis
           thaliana]; identical to cDNA DEAD box RNA helicase, RH13
           GI:3776002
          Length = 832

 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 22/64 (34%), Positives = 39/64 (60%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRV 243
           +ALI+ PTRELA Q+ + +     +L+ K    +GG    +  R+L+    +VV TPGR+
Sbjct: 281 RALIITPTRELALQVTEHLENAAKNLSVKVVPIVGGMFSEKQERRLKEKPEIVVATPGRL 340

Query: 244 YDMI 255
           ++++
Sbjct: 341 WELM 344



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 11/36 (30%), Positives = 21/36 (58%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKIL 365
           +  +  +++  FVLDEAD M+ RG   ++  +  +L
Sbjct: 349 KHLVELHSLSFFVLDEADRMVERGHFRELQSILDLL 384


>At1g71280.1 68414.m08226 DEAD/DEAH box helicase, putative contains
           Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 465

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 32/97 (32%), Positives = 49/97 (50%), Gaps = 6/97 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSI------RECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT  F +  ++ I  S        +   +I++PTREL+ QI KV  A+     AKC   
Sbjct: 66  GKTLAFLLPFIEIIRRSNSYPPKPHQVMGVIISPTRELSAQIHKVARAVRLDF-AKCREV 124

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMILVVRFM 273
               N  E     E G ++++GTPGR+ DM+  + F+
Sbjct: 125 EADMNTLE-----EEGANLLIGTPGRLSDMMKRMEFL 156



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/61 (29%), Positives = 34/61 (55%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L    +++ +LDEAD +L  GF+ Q++ +   L    +  L SAT    V ++++  +R+
Sbjct: 156 LDFRNLEILILDEADRLLDMGFQKQVNYIISRLPKQRRTGLFSATQTQAVADLAKAGLRN 215

Query: 447 P 449
           P
Sbjct: 216 P 216


>At1g63250.1 68414.m07150 DEAD box RNA helicase, putative similar to
           RNA helicase (RH25) [Arabidopsis thaliana] GI:3776023;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain
          Length = 798

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 20/54 (37%), Positives = 33/54 (61%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           +KLF++DEAD +L  GF+  +  +   L    Q +L SAT+P +V  VS+  ++
Sbjct: 485 LKLFIVDEADLLLDLGFRRDVEKIIDCLPRQRQSLLFSATIPKEVRRVSQLVLK 538



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 28/67 (41%), Positives = 39/67 (58%), Gaps = 4/67 (5%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQ---KVVIALGDHLNAKCHACIGGTNVREDIRQLES-GVHVVVGTP 234
           ALIL PTRELA QI    K ++   D +  +    IGGT  + D ++LES    +++ TP
Sbjct: 408 ALILCPTRELASQIAAEGKALLKFHDGIGVQ--TLIGGTRFKLDQQRLESEPCQILIATP 465

Query: 235 GRVYDMI 255
           GR+ D I
Sbjct: 466 GRLLDHI 472


>At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong
           similarity to RNA helicase RH26 [Arabidopsis thaliana]
           GI:3776025; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain; identical to cDNA DEAD box RNA helicase, RH26
           GI:3776024
          Length = 850

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 18/48 (37%), Positives = 29/48 (60%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEV 425
           +K+ VLDEAD +L  GF+  I  +   +    Q  L SAT+P++V ++
Sbjct: 538 VKVLVLDEADHLLDMGFRRDIERIIAAVPKQRQTFLFSATVPEEVRQI 585



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 2/64 (3%)
 Frame = +1

Query: 70  LILAPTRELAQQ-IQKVVIALGDHLNAKCHACIGGTNVREDIRQLESG-VHVVVGTPGRV 243
           L++ PTRELA Q   +    L  H +      IGGT +  + R++++    ++V TPGR+
Sbjct: 462 LVVCPTRELASQAAAEANTLLKYHPSIGVQVVIGGTKLPTEQRRMQTNPCQILVATPGRL 521

Query: 244 YDMI 255
            D I
Sbjct: 522 KDHI 525


>At1g12770.1 68414.m01482 DEAD/DEAH box helicase family protein /
           pentatricopeptide (PPR) repeat-containing protein
           contains Pfam profiles:  PF00271 helicase conserved
           C-terminal domain, PF01535 PPR repeat, PF00270:
           DEAD/DEAH box helicase
          Length = 1145

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 28/86 (32%), Positives = 46/86 (53%), Gaps = 14/86 (16%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILS--------------ADVQVILLSATM 404
           LH +  +  VLDE DE+LS  F++ IH + + +               A+ Q IL+SAT+
Sbjct: 263 LHTHGCRFLVLDEVDELLSFNFREDIHRILEHVGKRSGAGPKGEVDERANRQTILVSATV 322

Query: 405 PDDVLEVSRCFMRDPVRILVQKEELT 482
           P  V+  ++ +  +PV  LVQ  ++T
Sbjct: 323 PFSVIRAAKSWSHEPV--LVQANKVT 346



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 25/67 (37%), Positives = 40/67 (59%), Gaps = 2/67 (2%)
 Frame = +1

Query: 58  ECQALILAPTRELAQQI-QKVVIALGDHLNAKCHACIGGTN-VREDIRQLESGVHVVVGT 231
           E QA+I+AP+REL  QI ++V   LG          +GG N +R++    ++   +VVGT
Sbjct: 191 EIQAMIVAPSRELGMQIVREVEKLLGPVHRRMVQQLVGGANRMRQEEALKKNKPAIVVGT 250

Query: 232 PGRVYDM 252
           PGR+ ++
Sbjct: 251 PGRIAEI 257


>At5g08620.1 68418.m01025 DEAD box RNA helicase (RH25) identical to
           RNA helicase [Arabidopsis thaliana] GI:3776023; contains
           Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271:
           Helicase conserved C-terminal domain
          Length = 563

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR---DPV 452
           +K+ VLDEAD +L  GF+ +I  +   +    Q  L SAT+ D+V ++    ++   + V
Sbjct: 236 VKVLVLDEADHLLDMGFRREIERIIAAVPKQRQTFLFSATVSDEVRQICHVALKRDHEFV 295

Query: 453 RILVQKEELTLEGIKQFYM 509
             + +    T + + Q YM
Sbjct: 296 NCVQEGAGETHQKVSQMYM 314



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = +1

Query: 70  LILAPTRELA-QQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE-SGVHVVVGTPGRV 243
           L++ PTRELA Q   +  I L  H +      IGGT +  + R+L+ S   ++V TPGR+
Sbjct: 160 LVVCPTRELACQAAAEANILLKYHPSIGVQVVIGGTKLPTEQRRLQKSPCQILVATPGRL 219

Query: 244 YDMI 255
            D I
Sbjct: 220 KDHI 223


>At3g06980.1 68416.m00829 DEAD/DEAH box helicase, putative contains
           Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 781

 Score = 36.3 bits (80), Expect = 0.022
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 10/90 (11%)
 Frame = +1

Query: 1   GKTATFSISILQQI--------DTSIREC-QALILAPTRELAQQIQKVVIALG-DHLNAK 150
           GKT  + + ++Q++          S   C + ++L PT ELA Q+     ++    +  +
Sbjct: 423 GKTLAYLVPVIQRLREEELQGHSKSSPGCPRVIVLVPTAELASQVLANCRSISKSGVPFR 482

Query: 151 CHACIGGTNVREDIRQLESGVHVVVGTPGR 240
                GG   R  +  LE GV V++ TPGR
Sbjct: 483 SMVVTGGFRQRTQLENLEQGVDVLIATPGR 512


>At5g19210.2 68418.m02287 DEAD/DEAH box helicase, putative
           EUKARYOTIC INITIATION FACTOR 4A-II (EIF-4A-II), Homo
           sapiens, SWISSPROT:IF42_HUMAN
          Length = 472

 Score = 35.9 bits (79), Expect = 0.030
 Identities = 17/39 (43%), Positives = 23/39 (58%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKV 117
           GKT T+ + I   I+      QA+I+ PTREL  Q+ KV
Sbjct: 125 GKTLTYLLLIFSLINPQRSSVQAVIVVPTRELGMQVTKV 163


>At2g40700.1 68415.m05021 DEAD/DEAH box helicase, putative (RH17)
           identical to GB:CAA09207, contains a DEAD/DEAH box
           family ATP-dependent helicas signature; identical to
           cDNA DEAD box RNA helicase, RH17 GI:3776008
          Length = 609

 Score = 35.9 bits (79), Expect = 0.030
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACI-GGTNVREDIRQLESGVHVVVGTPGRV 243
           AL++ PTREL  Q+ + +  L    +      + GG    ++  +L  G+ +++ TPGR+
Sbjct: 107 ALVIVPTRELCLQVYETLEKLLHRFHWIVPGYVMGGEKKAKEKARLRKGISILIATPGRL 166

Query: 244 YD 249
            D
Sbjct: 167 LD 168


>At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing
           protein contains Pfam profile PF00515 TPR Domain
          Length = 691

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 14/53 (26%), Positives = 33/53 (62%), Gaps = 2/53 (3%)
 Frame = +1

Query: 19  SISILQQIDTSIREC-QALILAPTRELA-QQIQKVVIALGDHLNAKCHACIGG 171
           +++ L+++  +++EC +A+ + P+   A Q++  + + LG+  NA+ H C  G
Sbjct: 263 ALTALRRLGEAVKECLEAVRIDPSYSRAHQRLASLYLRLGEAENARRHICFSG 315


>At4g14090.1 68417.m02175 UDP-glucoronosyl/UDP-glucosyl transferase
           family protein contains Pfam profile: PF00201
           UDP-glucoronosyl and UDP-glucosyl transferase ;similar
           to UDP-glucose:anthocyanin 5-O-glucosyltransferase
           GI:4115563 from [Verbena x hybrida]
          Length = 456

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 14/34 (41%), Positives = 18/34 (52%)
 Frame = -1

Query: 267 AHDEYHIIYTTWSAHHHMNTTLQLANIFTDIGAT 166
           +H   H +  T+ A  H+N  LQLAN     GAT
Sbjct: 8   SHRRPHYLLVTFPAQGHINPALQLANRLIHHGAT 41


>At4g14365.1 68417.m02213 zinc finger (C3HC4-type RING finger)
           family protein / ankyrin repeat family protein contains
           Pfam profile: PF00097 zinc finger, C3HC4 type (RING
           finger) and Pfam profile: PF00023 ankyrin repeat
          Length = 376

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           LILA T +    + K ++ LG ++NA    C GGT
Sbjct: 46  LILACTNDDLYDVAKTLLELGSNVNAYRSGCNGGT 80


>At2g04620.1 68415.m00470 cation efflux family protein potential
           member of the cation diffusion facilitator (CDF) family,
           or cation efflux (CE) family, see PMID:11500563
          Length = 798

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 15/40 (37%), Positives = 18/40 (45%)
 Frame = -3

Query: 247 HIHDLECPPPHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQ 128
           H H+ EC   H+H        H H   +C H   H SDHQ
Sbjct: 606 HKHE-ECNHNHDHE----HQSHSHNHEECNHNHDHHSDHQ 640


>At4g08990.1 68417.m01485 DNA (cytosine-5-)-methyltransferase,
           putative strong similarity to cytosine-5
           methyltransferase (METII) [Arabidopsis thaliana]
           GI:6523846; contains Pfam profiles PF01426: BAH domain,
           PF00145: C-5 cytosine-specific DNA methylase
          Length = 1512

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = +1

Query: 115 VVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVG 228
           V+++L DH ++K H  +    +R D  QL    H+V G
Sbjct: 250 VLVSLRDHESSKIHKALSNVALRIDESQLVKSDHLVDG 287


>At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containing
           protein contains Pfam profile PF00515 TPR Domain
          Length = 682

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 13/47 (27%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Frame = +1

Query: 37  QIDTSIREC-QALILAPTRELA-QQIQKVVIALGDHLNAKCHACIGG 171
           +++ +++EC +A+   P+   A Q++  + + LG+  NA+ H C+ G
Sbjct: 260 RLEEAVKECLEAVRCDPSYARAHQRLASLYLRLGEAENARRHLCVSG 306


>At3g47150.1 68416.m05119 F-box family protein various predicted
           proteins, Arabidopsis thaliana
          Length = 360

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 16/44 (36%), Positives = 25/44 (56%)
 Frame = +1

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKV 492
           F Q+ FK+Y  + PC+M +  Y D + E  Y  L    +LPW++
Sbjct: 140 FPQIKFKNYPDIFPCIMYFLGY-DRI-EDQYKVL-AIDNLPWRL 180


>At2g33170.1 68415.m04064 leucine-rich repeat transmembrane protein
           kinase, putative similar to receptor protein kinase
           [Pinus sylvestris] gi|12054894|emb|CAC20842; contains
           leucine rich repeat (LRR) domains, Pfam:PF00560;
           contains protein kinase domain, Pfam:PF00069
          Length = 1124

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = -3

Query: 631 HRFSEPIPPCDGCCRKLQ 578
           +RFS P+PP  G C+KLQ
Sbjct: 503 NRFSGPLPPEIGTCQKLQ 520


>At2g30240.1 68415.m03680 cation/hydrogen exchanger, putative
           (CHX13) monovalent cation:proton antiporter family 2
           (CPA2) member, PMID:11500563
          Length = 831

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +1

Query: 220 VVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSS 357
           V+ + G  YDM+LV R     S+ L+ +     CPE+     M++S
Sbjct: 728 VISSLGDAYDMVLVGRDHDLESSVLYGLTDWSECPELGVIGDMLTS 773


>At2g15490.2 68415.m01773 UDP-glucoronosyl/UDP-glucosyl transferase
           family protein contains Pfam profile: PF00201
           UDP-glucoronosyl and UDP-glucosyl transferase
          Length = 270

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = -1

Query: 261 DEYHIIYTTWSAHHHMNTTLQLANIFTDIGATNASMAFSI 142
           ++ HI++  + AH HM   L +A +F   GA +  +   I
Sbjct: 4   EQIHILFFPFMAHGHMIPLLDMAKLFARRGAKSTLLTTPI 43


>At2g15490.1 68415.m01772 UDP-glucoronosyl/UDP-glucosyl transferase
           family protein contains Pfam profile: PF00201
           UDP-glucoronosyl and UDP-glucosyl transferase
          Length = 484

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = -1

Query: 261 DEYHIIYTTWSAHHHMNTTLQLANIFTDIGATNASMAFSI 142
           ++ HI++  + AH HM   L +A +F   GA +  +   I
Sbjct: 4   EQIHILFFPFMAHGHMIPLLDMAKLFARRGAKSTLLTTPI 43


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,297,885
Number of Sequences: 28952
Number of extensions: 409969
Number of successful extensions: 1292
Number of sequences better than 10.0: 73
Number of HSP's better than 10.0 without gapping: 1116
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1269
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1712086600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).