SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30026
         (796 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g13050.1 68416.m01626 transporter-related low similarity to a...    39   0.003
At5g13740.1 68418.m01599 sugar transporter family protein contai...    37   0.018
At3g43790.3 68416.m04680 transporter-related low similarity to S...    33   0.22 
At3g43790.2 68416.m04679 transporter-related low similarity to S...    33   0.22 
At3g43790.1 68416.m04678 transporter-related low similarity to S...    33   0.22 
At5g13750.1 68418.m01600 transporter-related                           32   0.38 
At5g27360.1 68418.m03267 sugar-porter family protein 2 (SFP2) id...    30   2.0  
At1g12940.1 68414.m01503 high-affinity nitrate transporter, puta...    29   2.7  
At1g75220.1 68414.m08738 integral membrane protein, putative str...    29   3.6  
At1g19450.1 68414.m02423 integral membrane protein, putative / s...    29   3.6  
At5g27350.1 68418.m03266 sugar-porter family protein 1 (SFP1) id...    29   4.7  
At3g18830.1 68416.m02391 mannitol transporter, putative similar ...    29   4.7  
At1g08890.1 68414.m00989 sugar transporter family protein simila...    29   4.7  
At5g36790.1 68418.m04408 phosphoglycolate phosphatase, putative ...    28   6.2  
At5g36700.1 68418.m04392 phosphoglycolate phosphatase, putative ...    28   6.2  
At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p...    28   8.2  
At3g03670.1 68416.m00370 peroxidase, putative similar to peroxid...    28   8.2  
At2g40280.1 68415.m04958 dehydration-responsive family protein s...    28   8.2  
At1g27640.1 68414.m03377 expressed protein                             28   8.2  
At1g14630.1 68414.m01739 hypothetical protein                          28   8.2  

>At3g13050.1 68416.m01626 transporter-related low similarity to
           apical organic cation transporter [Sus scrofa]
           GI:2062135, SP|Q02563 Synaptic vesicle protein 2 (SV2)
           {Rattus norvegicus}; contains Pfam profile PF00083:
           major facilitator superfamily protein
          Length = 500

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 23/89 (25%), Positives = 38/89 (42%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXXXX 442
           A  ++  ++S+V PA +    L+  Q  LI     +G +  A+ WGIV D  GR+     
Sbjct: 36  AEAMEMMLLSFVGPAVQSLWNLSARQESLITSVVFAGMLIGAYSWGIVSDKHGRRKGFII 95

Query: 443 XXXXXXXXXXXQSTVPDYRLLLQLEPSMG 529
                       +  P+Y  L+ L   +G
Sbjct: 96  TAVVTFVAGFLSAFSPNYMWLIILRCLVG 124


>At5g13740.1 68418.m01599 sugar transporter family protein contains
           Pfam profile PF00083: major facilitator superfamily
           protein
          Length = 486

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = +2

Query: 335 YQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           + AG +  +FM G   ++ FWGIV D +GRK
Sbjct: 78  FYAGFVGCSFMLGRALTSVFWGIVADRYGRK 108


>At3g43790.3 68416.m04680 transporter-related low similarity to
           SP|P39843 Multidrug resistance protein 2
           (Multidrug-efflux transporter 2) {Bacillus subtilis};
           contains Pfam profile PF00083: major facilitator
           superfamily protein
          Length = 484

 Score = 33.1 bits (72), Expect = 0.22
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 335 YQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           + AG +  +FM G   ++ FWG + D +GRK
Sbjct: 76  FYAGFVGSSFMIGRALTSIFWGKLADRYGRK 106


>At3g43790.2 68416.m04679 transporter-related low similarity to
           SP|P39843 Multidrug resistance protein 2
           (Multidrug-efflux transporter 2) {Bacillus subtilis};
           contains Pfam profile PF00083: major facilitator
           superfamily protein
          Length = 484

 Score = 33.1 bits (72), Expect = 0.22
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 335 YQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           + AG +  +FM G   ++ FWG + D +GRK
Sbjct: 76  FYAGFVGSSFMIGRALTSIFWGKLADRYGRK 106


>At3g43790.1 68416.m04678 transporter-related low similarity to
           SP|P39843 Multidrug resistance protein 2
           (Multidrug-efflux transporter 2) {Bacillus subtilis};
           contains Pfam profile PF00083: major facilitator
           superfamily protein
          Length = 478

 Score = 33.1 bits (72), Expect = 0.22
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 335 YQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           + AG +  +FM G   ++ FWG + D +GRK
Sbjct: 76  FYAGFVGSSFMIGRALTSIFWGKLADRYGRK 106


>At5g13750.1 68418.m01600 transporter-related
          Length = 478

 Score = 32.3 bits (70), Expect = 0.38
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 335 YQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           + AG +  +FM G   ++  WG+V D +GRK
Sbjct: 77  FYAGFVGCSFMLGRAFTSVAWGLVADRYGRK 107


>At5g27360.1 68418.m03267 sugar-porter family protein 2 (SFP2)
           identical to sugar-porter family protein 2 [Arabidopsis
           thaliana] GI:14585701
          Length = 478

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 704 SCQFTPWRLFLAWGSLPGFMRESGVLYLPES 796
           S  F  WR+    G+LP F++  G+ ++PES
Sbjct: 180 SGNFLNWRILALLGALPCFIQVIGLFFVPES 210


>At1g12940.1 68414.m01503 high-affinity nitrate transporter,
           putative similar to trans-membrane nitrate transporter
           protein AtNRT2:1 [Arabidopsis thaliana] GI:3747058,
           high-affinity nitrate transporter ACH1 [Arabidopsis
           thaliana] GI:3608362
          Length = 502

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 18/55 (32%), Positives = 23/55 (41%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFG 421
           FF   V       +LP  R  L LT    G   +A +SG V +    G   D+FG
Sbjct: 54  FFCCFVSTFAAPPLLPVIRENLNLTATDIGNAGIASVSGAVFARIVMGTACDLFG 108


>At1g75220.1 68414.m08738 integral membrane protein, putative strong
           similarity to integral membrane protein GI:1209756 from
           [Beta vulgaris]; contains Pfam profile PF00083: major
           facilitator superfamily protein
          Length = 487

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +2

Query: 713 FTPWRLFLAWGSLPGFMRESGVLYLPES 796
           F PWR+    G LP  +   G+ ++PES
Sbjct: 196 FVPWRILAVLGILPCTLLIPGLFFIPES 223


>At1g19450.1 68414.m02423 integral membrane protein, putative /
           sugar transporter family protein similar to GB:U43629
           GI:1209756 integral membrane protein from [Beta
           vulgaris]; contains Pfam profile PF00083: major
           facilitator superfamily protein; contains TIGRfam
           TIGR00879: Sugar transporter
          Length = 488

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +2

Query: 713 FTPWRLFLAWGSLPGFMRESGVLYLPES 796
           F PWR+    G LP  +   G+ ++PES
Sbjct: 197 FVPWRILAVLGVLPCTLLIPGLFFIPES 224


>At5g27350.1 68418.m03266 sugar-porter family protein 1 (SFP1)
           identical to sugar-porter family protein 1 [Arabidopsis
           thaliana] GI:14585699
          Length = 474

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +2

Query: 713 FTPWRLFLAWGSLPGFMRESGVLYLPES 796
           F  WR     G+LP F++  G+ ++PES
Sbjct: 179 FITWRTLALLGALPCFIQVIGLFFVPES 206


>At3g18830.1 68416.m02391 mannitol transporter, putative similar to
           mannitol transporter [Apium graveolens var. dulce]
           GI:12004316; contains Pfam profile PF00083: major
           facilitator superfamily protein
          Length = 539

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +2

Query: 722 WRLFLAWGSLPGFMRESGVLYLPES 796
           WRL L  G++P  +   GVL +PES
Sbjct: 194 WRLMLGIGAVPSVILAIGVLAMPES 218


>At1g08890.1 68414.m00989 sugar transporter family protein similar
           to sugar-porter family proteins 1 and 2 [Arabidopsis
           thaliana] GI:14585699, GI:14585701; contains Pfam
           profile PF00083: major facilitator superfamily protein
          Length = 464

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 21/65 (32%), Positives = 26/65 (40%), Gaps = 3/65 (4%)
 Frame = +2

Query: 242 SVRVPFFASGVQNCIMSYVLPAARC---ELQLTTYQAGLINMAFMSGGVASAFFWGIVGD 412
           S  V    S V  C MSY  PA      EL L+             GG+ +A F G +  
Sbjct: 30  STSVAVTGSFVYGCAMSYSSPAQSKIMEELGLSVADYSFFTSVMTLGGMITAAFSGKIAA 89

Query: 413 VFGRK 427
           V GR+
Sbjct: 90  VIGRR 94


>At5g36790.1 68418.m04408 phosphoglycolate phosphatase, putative
           similar to phosphoglycolate phosphatase precursor
           [Chlamydomonas reinhardtii] GI:15982558; contains
           InterPro accession IPR005834: Haloacid dehalogenase-like
           hydrolase
          Length = 362

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 12/30 (40%), Positives = 20/30 (66%)
 Frame = +1

Query: 532 IIGGPATLVFTYLSDLVGVKKRQFYLSMVG 621
           ++G P+T +  YL+D  G++K Q  + MVG
Sbjct: 278 VVGKPSTFMMDYLADKFGIQKSQ--ICMVG 305


>At5g36700.1 68418.m04392 phosphoglycolate phosphatase, putative
           similar to phosphoglycolate phosphatase precursor
           [Chlamydomonas reinhardtii] GI:15982558; contains
           InterPro accession IPR005834: Haloacid dehalogenase-like
           hydrolase
          Length = 362

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 12/30 (40%), Positives = 20/30 (66%)
 Frame = +1

Query: 532 IIGGPATLVFTYLSDLVGVKKRQFYLSMVG 621
           ++G P+T +  YL+D  G++K Q  + MVG
Sbjct: 278 VVGKPSTFMMDYLADKFGIQKSQ--ICMVG 305


>At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier,
           putative / a bout de souffle (BOU) / CAC-like protein
           identical to SP|Q93XM7 Mitochondrial
           carnitine/acylcarnitine carrier-like protein (A BOUT DE
           SOUFFLE) (Carnitine/acylcarnitine translocase-like
           protein) (CAC-like protein) {Arabidopsis thaliana};
           contains Pfam profile: PF00153 mitochondrial carrier
           protein
          Length = 300

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 11/14 (78%), Positives = 12/14 (85%)
 Frame = +2

Query: 365 MSGGVASAFFWGIV 406
           M+GGVA A FWGIV
Sbjct: 218 MAGGVAGASFWGIV 231


>At3g03670.1 68416.m00370 peroxidase, putative similar to peroxidase
           GB:CAA66966 [Arabidopsis thaliana]
          Length = 321

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 12/37 (32%), Positives = 17/37 (45%)
 Frame = +3

Query: 633 CGLVTFACTRLDGDSI*NPGLSNALANLLRGGCSLPG 743
           CG      T   G  + +P +   LA  LR  C++PG
Sbjct: 196 CGNFVDRVTNFQGTGLPDPSMDPTLAGRLRNTCAVPG 232


>At2g40280.1 68415.m04958 dehydration-responsive family protein
           similar to early-responsive to dehydration stress ERD3
           protein [Arabidopsis thaliana] GI:15320410; contains
           Pfam profile PF03141: Putative methyltransferase
          Length = 589

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 2/64 (3%)
 Frame = -2

Query: 486 TVLWAKVIAASRSNVKLRVLFLPKTSPTIPQKNALATPPLIKAMLINPAWYV--VSCSSH 313
           ++ W  V     S+    V++   TS +   K +   PPL      N +WYV    C S 
Sbjct: 329 SICWKVVTKTVDSSGIGLVIYQKPTSESCYNKRSTQDPPLCDKKEANGSWYVPLAKCLSK 388

Query: 312 LAAG 301
           L +G
Sbjct: 389 LPSG 392


>At1g27640.1 68414.m03377 expressed protein
          Length = 147

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 14/38 (36%), Positives = 19/38 (50%)
 Frame = +2

Query: 104 SENRPENRKPHSQRHGNLTRCHRRDGGLRNRAGQSRVR 217
           SE     RK   ++H      HR +  L+NRAG+ R R
Sbjct: 5   SETEQYKRKAEIEKHTKEPNKHRDEAVLQNRAGRHRDR 42


>At1g14630.1 68414.m01739 hypothetical protein
          Length = 151

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 10/21 (47%), Positives = 15/21 (71%)
 Frame = +2

Query: 98  NGSENRPENRKPHSQRHGNLT 160
           NG+E++P+N   HSQ H  L+
Sbjct: 30  NGAEDKPDNDLDHSQNHWGLS 50


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,963,640
Number of Sequences: 28952
Number of extensions: 436197
Number of successful extensions: 1076
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 1031
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1074
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1794809600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).