SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30025
         (734 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g22360.1 68417.m03232 SWIB complex BAF60b domain-containing p...    31   0.79 
At4g01350.1 68417.m00175 DC1 domain-containing protein contains ...    28   5.6  
At1g68880.1 68414.m07883 bZIP transcription factor family protei...    28   7.4  
At2g48110.1 68415.m06022 expressed protein                             27   9.8  
At2g26860.1 68415.m03222 F-box family protein contains F-box dom...    27   9.8  

>At4g22360.1 68417.m03232 SWIB complex BAF60b domain-containing
           protein contains Pfam profile PF02201: BAF60b domain of
           the SWIB complex
          Length = 385

 Score = 31.1 bits (67), Expect = 0.79
 Identities = 13/26 (50%), Positives = 17/26 (65%)
 Frame = +2

Query: 473 R*LLGCRLFICVNLNKAWRRHMFKES 550
           R LLGC     V +N+  RRHM+K+S
Sbjct: 360 RDLLGCESISAVGINEMLRRHMYKQS 385


>At4g01350.1 68417.m00175 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 652

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 12/38 (31%), Positives = 19/38 (50%)
 Frame = +1

Query: 613 WFYTTMT*GLV*KGNHVIGEWFPQ*IGVPYWAGENLGY 726
           WFYT    G+      V+G++    +G  YW GE + +
Sbjct: 565 WFYTCFDCGVTLHAQCVLGDFSRLVLGQNYWFGEKVKF 602


>At1g68880.1 68414.m07883 bZIP transcription factor family protein
           similar to common plant regulatory factor 6 GI:9650826
           from [Petroselinum crispum]; contains Pfam profile:
           PF00170 bZIP transcription factor
          Length = 138

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 12/43 (27%), Positives = 23/43 (53%)
 Frame = +1

Query: 82  ETWSLLNTLFHSMEVYVESENNVQKCIEIIIVHNVMVGETNQE 210
           E WS+L  L +  +  V+  +  ++C E +I  N+ + E N +
Sbjct: 72  ELWSMLVQLINKNKSLVDELSQARECYEKVIEENMKLREENSK 114


>At2g48110.1 68415.m06022 expressed protein
          Length = 1295

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -1

Query: 695 TPIYWGNHSPMTW 657
           T I+W NHSP++W
Sbjct: 57  THIFWENHSPLSW 69


>At2g26860.1 68415.m03222 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 405

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 12/35 (34%), Positives = 17/35 (48%)
 Frame = -3

Query: 696 YANLLGKPFSNDMVSFSHKSLCHCRIEPINLESCF 592
           +A    +P   D VSF  K  CH +   I+  SC+
Sbjct: 368 FAGYTRRPEERDFVSFILKHACHLKSSSISRLSCY 402


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,934,237
Number of Sequences: 28952
Number of extensions: 294863
Number of successful extensions: 584
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 572
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 584
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1614253080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).