SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30024
         (540 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) simila...    88   3e-18
At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) simila...    87   7e-18
At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) simila...    87   9e-18
At2g29210.1 68415.m03550 splicing factor PWI domain-containing p...    30   1.1  
At5g08320.1 68418.m00979 expressed protein predicted proteins, H...    29   2.6  
At5g35338.2 68418.m04194 methyl-CpG-binding domain-containing pr...    28   3.5  
At1g20540.1 68414.m02559 transducin family protein / WD-40 repea...    28   4.6  
At5g35330.2 68418.m04188 methyl-CpG-binding domain-containing pr...    27   8.0  
At5g35330.1 68418.m04187 methyl-CpG-binding domain-containing pr...    27   8.0  

>At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) similar
           to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309
           from [Cyanophora paradoxa]
          Length = 233

 Score = 88.2 bits (209), Expect = 3e-18
 Identities = 48/86 (55%), Positives = 57/86 (66%), Gaps = 4/86 (4%)
 Frame = +3

Query: 237 TQDPTQLKI----GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRY 404
           T  PT+L+     GTV I+LAGR  GKRVV +  L SGLLLVTGPF  N  PLRR+ Q Y
Sbjct: 79  TAKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLASGLLLVTGPFKINGVPLRRVNQAY 138

Query: 405 VIGTSTRISLGNFKLPKHFNDDYFKK 482
           VIGTST++ +    L K F+D YF K
Sbjct: 139 VIGTSTKVDISGVTLDK-FDDKYFGK 163


>At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) similar
           to 60S ribosomal protein L6 GI:7208784 from [Cicer
           arietinum]
          Length = 233

 Score = 87.0 bits (206), Expect = 7e-18
 Identities = 48/83 (57%), Positives = 55/83 (66%), Gaps = 4/83 (4%)
 Frame = +3

Query: 246 PTQLKI----GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIG 413
           PT+LK     GTV I+LAGR  GKRVV +  L SGLLLVTGPF  N  PLRR+ Q YVIG
Sbjct: 82  PTKLKASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPLRRVNQAYVIG 141

Query: 414 TSTRISLGNFKLPKHFNDDYFKK 482
           TST+I +      K F+D YF K
Sbjct: 142 TSTKIDISGVNTEK-FDDKYFGK 163


>At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) similar
           to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309
           from [Cyanophora paradoxa]
          Length = 233

 Score = 86.6 bits (205), Expect = 9e-18
 Identities = 44/73 (60%), Positives = 51/73 (69%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GTV I+LAGR  GKRVV +  L SGLLLVTGPF  N  PLRR+ Q YVIGTST++ +   
Sbjct: 92  GTVLIILAGRFKGKRVVFLKQLASGLLLVTGPFKINGVPLRRVNQAYVIGTSTKVDISGV 151

Query: 444 KLPKHFNDDYFKK 482
            L K F+D YF K
Sbjct: 152 TLDK-FDDKYFGK 163


>At2g29210.1 68415.m03550 splicing factor PWI domain-containing
           protein contains Pfam profile PF01480: PWI domain
          Length = 878

 Score = 29.9 bits (64), Expect = 1.1
 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 1/31 (3%)
 Frame = +1

Query: 154 PLKRRKSFYPTQEKIRASSGGRPFS-KHVRR 243
           P++RR+S  P +E++  S GGR  S  H+++
Sbjct: 525 PVRRRRSLTPDEERVSLSQGGRHTSPSHIKQ 555


>At5g08320.1 68418.m00979 expressed protein predicted proteins, Homo
           sapiens and Caenorhabditis elegans
          Length = 150

 Score = 28.7 bits (61), Expect = 2.6
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = -2

Query: 416 GADHIALRNTA*RARIESKRSSN*KQTAGQNSNKYNPLACMSTSEE 279
           G D +  +NT      + +R S  ++T  ++S K NP+ C + S E
Sbjct: 85  GTDTVLQQNTMPLKVGKRRRDSEMQETGSEDSEKVNPVFCSACSTE 130


>At5g35338.2 68418.m04194 methyl-CpG-binding domain-containing
           protein contains Pfam profile PF01429:Methyl-CpG binding
           domain
          Length = 155

 Score = 28.3 bits (60), Expect = 3.5
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = +3

Query: 438 NFKLPKHFNDDYFKKNKKCVKRTVNAK 518
           +F++PK  +D+Y KK  + VKR  ++K
Sbjct: 120 SFQIPKPLDDNYVKKRTRPVKRRKSSK 146


>At1g20540.1 68414.m02559 transducin family protein / WD-40 repeat
           family protein contains 6 WD-40 repeats (PF00400);
           similar to Rbap46 polypeptide (GI:9454362) [Gallus
           gallus]
          Length = 351

 Score = 27.9 bits (59), Expect = 4.6
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
 Frame = +3

Query: 120 WR*EEWGNQNSTPQT*EV--LLPHSGENPCFIWWPS 221
           W+  E   Q ++PQ   V  L  H G+  C +WWPS
Sbjct: 96  WQIPELYGQLNSPQLERVASLDAHVGKINCVLWWPS 131


>At5g35330.2 68418.m04188 methyl-CpG-binding domain-containing
           protein similar to methyl-CpG binding protein MBD4 [Mus
           musculus] GI:3800807; contains Pfam profile PF01429:
           Methyl-CpG binding domain
          Length = 272

 Score = 27.1 bits (57), Expect = 8.0
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = +3

Query: 408 IGTSTRISLGNFKLPKHFNDDYFKK 482
           IG   ++S  +F++PK   DDY +K
Sbjct: 176 IGEGVKLSQFSFQIPKPLQDDYVRK 200


>At5g35330.1 68418.m04187 methyl-CpG-binding domain-containing
           protein similar to methyl-CpG binding protein MBD4 [Mus
           musculus] GI:3800807; contains Pfam profile PF01429:
           Methyl-CpG binding domain
          Length = 272

 Score = 27.1 bits (57), Expect = 8.0
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = +3

Query: 408 IGTSTRISLGNFKLPKHFNDDYFKK 482
           IG   ++S  +F++PK   DDY +K
Sbjct: 176 IGEGVKLSQFSFQIPKPLQDDYVRK 200


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,873,325
Number of Sequences: 28952
Number of extensions: 247897
Number of successful extensions: 607
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 597
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 607
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1003808112
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).